SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY227001-1|AAO32818.2|  301|Anopheles gambiae ADP/ATP translocas...   144   2e-36
L11618-1|AAB04104.1|  301|Anopheles gambiae ADP/ATP carrier prot...   143   4e-36
L11617-1|AAB04105.1|  301|Anopheles gambiae ADP/ATP carrier prot...   143   4e-36
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    25   3.1  
AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome convers...    23   9.5  
AJ439060-17|CAD27768.1|  568|Anopheles gambiae putative chitin b...    23   9.5  

>AY227001-1|AAO32818.2|  301|Anopheles gambiae ADP/ATP translocase
           protein.
          Length = 301

 Score =  144 bits (350), Expect = 2e-36
 Identities = 68/93 (73%), Positives = 71/93 (76%)
 Frame = +2

Query: 230 PHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXX 409
           P  QG G+  FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRYF      
Sbjct: 64  PKEQGIGA--FWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYFLGNLGS 121

Query: 410 XXXXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
                 TSLCFVYPLDFARTRL ADVG+G G+R
Sbjct: 122 GGAAGATSLCFVYPLDFARTRLGADVGRGAGER 154



 Score =  116 bits (278), Expect = 1e-27
 Identities = 57/69 (82%), Positives = 61/69 (88%)
 Frame = +3

Query: 48  MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 227
           M+  ADP  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ  SKQIA D++YKGIVD F
Sbjct: 1   MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60

Query: 228 VRIPKEQGL 254
           VRIPKEQG+
Sbjct: 61  VRIPKEQGI 69



 Score = 60.9 bits (141), Expect = 4e-11
 Identities = 25/32 (78%), Positives = 29/32 (90%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFG +DTA+GMLPDPKNT I +SWA
Sbjct: 186 IIIYRAAYFGCFDTAKGMLPDPKNTSIFVSWA 217



 Score = 39.9 bits (89), Expect = 8e-05
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +C+ K  KSDG+IGLYRGF
Sbjct: 156 FNGLLDCLKKTVKSDGIIGLYRGF 179


>L11618-1|AAB04104.1|  301|Anopheles gambiae ADP/ATP carrier protein
           protein.
          Length = 301

 Score =  143 bits (347), Expect = 4e-36
 Identities = 68/93 (73%), Positives = 70/93 (75%)
 Frame = +2

Query: 230 PHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXX 409
           P  QG G+  FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRYF      
Sbjct: 64  PKEQGIGA--FWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYFLGNLGS 121

Query: 410 XXXXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
                 TSLCFVYPLDFARTRL ADVG G G+R
Sbjct: 122 GGAAGATSLCFVYPLDFARTRLGADVGPGAGER 154



 Score =  116 bits (278), Expect = 1e-27
 Identities = 57/69 (82%), Positives = 61/69 (88%)
 Frame = +3

Query: 48  MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 227
           M+  ADP  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ  SKQIA D++YKGIVD F
Sbjct: 1   MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60

Query: 228 VRIPKEQGL 254
           VRIPKEQG+
Sbjct: 61  VRIPKEQGI 69



 Score = 60.9 bits (141), Expect = 4e-11
 Identities = 25/32 (78%), Positives = 29/32 (90%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFG +DTA+GMLPDPKNT I +SWA
Sbjct: 186 IIIYRAAYFGCFDTAKGMLPDPKNTSIFVSWA 217



 Score = 39.9 bits (89), Expect = 8e-05
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +C+ K  KSDG+IGLYRGF
Sbjct: 156 FNGLLDCLKKTVKSDGIIGLYRGF 179


>L11617-1|AAB04105.1|  301|Anopheles gambiae ADP/ATP carrier protein
           protein.
          Length = 301

 Score =  143 bits (347), Expect = 4e-36
 Identities = 68/93 (73%), Positives = 70/93 (75%)
 Frame = +2

Query: 230 PHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXX 409
           P  QG G+  FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRYF      
Sbjct: 64  PKEQGIGA--FWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYFLGNLGS 121

Query: 410 XXXXXXTSLCFVYPLDFARTRLAADVGKGDGQR 508
                 TSLCFVYPLDFARTRL ADVG G G+R
Sbjct: 122 GGAAGATSLCFVYPLDFARTRLGADVGPGAGER 154



 Score =  116 bits (278), Expect = 1e-27
 Identities = 57/69 (82%), Positives = 61/69 (88%)
 Frame = +3

Query: 48  MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 227
           M+  ADP  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ  SKQIA D++YKGIVD F
Sbjct: 1   MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60

Query: 228 VRIPKEQGL 254
           VRIPKEQG+
Sbjct: 61  VRIPKEQGI 69



 Score = 60.9 bits (141), Expect = 4e-11
 Identities = 25/32 (78%), Positives = 29/32 (90%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISWA 695
           IIIYRA+YFG +DTA+GMLPDPKNT I +SWA
Sbjct: 186 IIIYRAAYFGCFDTAKGMLPDPKNTSIFVSWA 217



 Score = 39.9 bits (89), Expect = 8e-05
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +C+ K  KSDG+IGLYRGF
Sbjct: 156 FNGLLDCLKKTVKSDGIIGLYRGF 179


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1154

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 9/28 (32%), Positives = 15/28 (53%)
 Frame = -1

Query: 440 STERWLRRHHRRPDYQRSNARTASSCQR 357
           + +RWLR HH    + ++     SS Q+
Sbjct: 698 AVDRWLREHHLELAHAKTEMTVISSLQQ 725


>AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome conversion
           enzyme protein.
          Length = 462

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = +2

Query: 305 QALNFAFKDKYKQVFLGGVDKKTQF 379
           Q +NFA+ D    + LG  D  T+F
Sbjct: 237 QGINFAWDDGIFSIALGNPDPVTKF 261


>AJ439060-17|CAD27768.1|  568|Anopheles gambiae putative chitin
           binding protein protein.
          Length = 568

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 12/26 (46%), Positives = 13/26 (50%)
 Frame = -3

Query: 267 RQNERDPAPWGCGRRRRRYPCNAGRR 190
           R   R P P      RRRYP NAG +
Sbjct: 332 RHRRRRPPPRR-RHDRRRYPTNAGHK 356


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 651,713
Number of Sequences: 2352
Number of extensions: 12444
Number of successful extensions: 46
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 73181328
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -