SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20005
         (763 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF127647-1|ABL74413.1|  213|Anopheles gambiae Rab5 protein.            73   1e-14
AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small...    48   3e-07
X87410-1|CAA60857.1|  498|Anopheles gambiae maltase-like protein...    29   0.16 
AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.    24   5.9  

>EF127647-1|ABL74413.1|  213|Anopheles gambiae Rab5 protein.
          Length = 213

 Score = 72.5 bits (170), Expect = 1e-14
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ +D   VK +IWDTAG
Sbjct: 23  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAG 82

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 83  QERYHSLAPMY 93



 Score = 69.3 bits (162), Expect = 1e-13
 Identities = 31/84 (36%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+ N  SF   K W++ ++  AS ++   + GNK DL + R V  E  +Q
Sbjct: 95  RGAQAAIVVYDIQNSDSFARAKTWVKELQRQASPNIVIALAGNKADLANSRVVDYEEAKQ 154

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A + ++ F+ETSAK ++NV   F
Sbjct: 155 YADDNRLLFMETSAKTAVNVNDIF 178


>AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small
           GTPase protein.
          Length = 190

 Score = 48.0 bits (109), Expect = 3e-07
 Identities = 22/61 (36%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ D+F   ++ T   ++    + +DG +V L +WDTAGQE 
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDSFPGEYVPTSFDNYSAPMV-VDGVQVSLGLWDTAGQED 66

Query: 230 F 232
           +
Sbjct: 67  Y 67


>X87410-1|CAA60857.1|  498|Anopheles gambiae maltase-like protein
           Agm1 protein.
          Length = 498

 Score = 29.1 bits (62), Expect = 0.16
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = +1

Query: 286 DVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQI 456
           D T ++ ++NIK W+  + EN  ++    +LGN    D++R VS   G   A  YQI
Sbjct: 329 DTTGQQFYDNIKRWLDVVPENRFSN---WVLGNH---DNKR-VSSRLGVARADLYQI 378


>AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.
          Length = 1036

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +1

Query: 352 SADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETS 474
           SA ++ + L  KC  + ++Q ++ + E  AI  + K +ETS
Sbjct: 241 SATLKDLKLAKKCTEEKEQQYNQFKQEMEAILARKKELETS 281


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 796,469
Number of Sequences: 2352
Number of extensions: 16346
Number of successful extensions: 24
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79002570
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -