SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20004
         (768 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small...    50   1e-07
EF127647-1|ABL74413.1|  213|Anopheles gambiae Rab5 protein.            39   2e-04
AY062192-1|AAL58553.1|  151|Anopheles gambiae cytochrome P450 CY...    27   0.48 
AY062191-1|AAL58552.1|  151|Anopheles gambiae cytochrome P450 CY...    26   1.5  
DQ182015-1|ABA56307.1|  353|Anopheles gambiae G(alpha)q2 protein.      25   2.6  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    25   2.6  
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    25   2.6  
DQ974172-1|ABJ52812.1|  409|Anopheles gambiae serpin 13 protein.       24   5.9  
CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.           24   5.9  
AY062199-1|AAL58560.1|  151|Anopheles gambiae cytochrome P450 CY...    24   5.9  
AY062195-1|AAL58556.1|  139|Anopheles gambiae cytochrome P450 CY...    24   5.9  

>AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small
           GTPase protein.
          Length = 190

 Score = 49.6 bits (113), Expect = 1e-07
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 1/118 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV+VGDG  GKT  +  + T  F  +YV T   + +      +  Q  L       +  
Sbjct: 8   KCVVVGDGTVGKTCMLISYTTDSFPGEYVPT-SFDNYSAPMVVDGVQVSLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
              L   +  + +V  + + V S  +++NV + W+ ++   C   PI+L G K+D+++
Sbjct: 67  YDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLRE 124


>EF127647-1|ABL74413.1|  213|Anopheles gambiae Rab5 protein.
          Length = 213

 Score = 38.7 bits (86), Expect = 2e-04
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 4/125 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE--VHPLVFHTNRGQFVLM-CGTQP 283
           FK VL+G+   GK++ V R + G+F +   +T+G       L       +F +     Q 
Sbjct: 25  FKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIWDTAGQE 84

Query: 284 DKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDI 460
              SL  +            V++D+ +  ++     W ++L R     I I L GNK D+
Sbjct: 85  RYHSLAPMYYRGA---QAAIVVYDIQNSDSFARAKTWVKELQRQASPNIVIALAGNKADL 141

Query: 461 KDRKV 475
            + +V
Sbjct: 142 ANSRV 146



 Score = 37.1 bits (82), Expect = 6e-04
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    + ++  +   ++F +WDTAGQE++  L   YY   Q AI
Sbjct: 58  GAAFLTQTLCIDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAI 101


>AY062192-1|AAL58553.1|  151|Anopheles gambiae cytochrome P450
           CYP4H17 protein.
          Length = 151

 Score = 27.5 bits (58), Expect = 0.48
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = +1

Query: 505 KDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPA 624
           +D++Y D+  K +     P  ++ RKL+ D  +    +PA
Sbjct: 57  QDMKYLDLVVKESLRLVPPVPFIGRKLLEDMEMNGTTIPA 96


>AY062191-1|AAL58552.1|  151|Anopheles gambiae cytochrome P450
           CYP4H16 protein.
          Length = 151

 Score = 25.8 bits (54), Expect = 1.5
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = +1

Query: 505 KDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPA 624
           ++L+Y D+  K +     P  ++ RKL+ D  +    +PA
Sbjct: 57  QELKYLDLVIKESLRLVPPVPFVGRKLLEDMEMNGTVVPA 96


>DQ182015-1|ABA56307.1|  353|Anopheles gambiae G(alpha)q2 protein.
          Length = 353

 Score = 25.0 bits (52), Expect = 2.6
 Identities = 9/18 (50%), Positives = 15/18 (83%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKR 169
           K +L+G G +GK+TF+K+
Sbjct: 35  KLLLLGTGESGKSTFIKQ 52


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 25.0 bits (52), Expect = 2.6
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +1

Query: 265 NVWDTAGQEKFGGLRDGYYI 324
           N+W +A  E FG  R G Y+
Sbjct: 305 NLWPSARVEMFGSFRTGLYL 324


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 25.0 bits (52), Expect = 2.6
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 2/83 (2%)
 Frame = -1

Query: 360 VTSNMTDSTLSLNIVSVSKTTKLLLSG--CVPHIKTNCPRFVWNTRGCTSTPRVATYFFS 187
           +T+  T++T +    + + T+          P I T  P  VW      S P   T +  
Sbjct: 119 ITTTTTEATTTTKFPTTTTTSAPTTPSQWTDPTITTTTP--VWTDPTTWSAPTTTTTWSD 176

Query: 186 NSPVKCLLTKVVLPVPPSPTNTH 118
             P     T  V   P + T TH
Sbjct: 177 QPPPPTTTTTTVWTDPTATTTTH 199


>DQ974172-1|ABJ52812.1|  409|Anopheles gambiae serpin 13 protein.
          Length = 409

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 167 RHLTGEFEKKYVATLGVEVHPLV 235
           RH++G+F + YV TL     PL+
Sbjct: 119 RHMSGDFPRDYVDTLKQLRSPLL 141


>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
          Length = 1664

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +2

Query: 287  KRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIV 436
            KR+L  L   T  + +  S   D  S +  + VPN +RDL+ +   +P V
Sbjct: 1053 KRNLDELRQATRLRVDAKSKSLDSCSDIL-QEVPNLNRDLINLFRQMPKV 1101


>AY062199-1|AAL58560.1|  151|Anopheles gambiae cytochrome P450
           CYP4H19 protein.
          Length = 151

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 10/40 (25%), Positives = 20/40 (50%)
 Frame = +1

Query: 505 KDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPA 624
           ++  Y D+  K +     P  ++ R+L+ D  +  V +PA
Sbjct: 57  QNFPYLDMVVKESLRLLPPVSFIGRRLVEDIQMNGVTIPA 96


>AY062195-1|AAL58556.1|  139|Anopheles gambiae cytochrome P450
           CYP4H18 protein.
          Length = 139

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = +1

Query: 505 KDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPA 624
           +D +Y D+  K +     P   + RKL+ D  +    +PA
Sbjct: 57  QDFKYLDMVIKESLRLVPPVPIIGRKLLEDMEINGAIIPA 96


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 893,151
Number of Sequences: 2352
Number of extensions: 19102
Number of successful extensions: 39
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79834176
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -