SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20002
         (732 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles ...    30   0.064
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            24   5.6  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            24   5.6  

>U50469-1|AAA93473.1|  160|Anopheles gambiae protein ( Anopheles
           gambiae putativecuticle protein mRNA, partial cds. ).
          Length = 160

 Score = 30.3 bits (65), Expect = 0.064
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = +3

Query: 270 EGKVV-GGYRVLLPDGRLMTVEYTVQGDSGF 359
           +G VV G Y V+ PDG   TV+YT    +GF
Sbjct: 45  DGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 75


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = -3

Query: 610  KRSRLIILINKKNTITDIMPETKLSCKIVS*VNDRKKKRLKIV 482
            ++S + +LI   +T T   PET  +  + +   D++K RLK++
Sbjct: 955  RQSTIDVLIEDLHTYTFNPPETDGNTFVFAYQLDKEKFRLKVI 997


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = -3

Query: 610  KRSRLIILINKKNTITDIMPETKLSCKIVS*VNDRKKKRLKIV 482
            ++S + +LI   +T T   PET  +  + +   D++K RLK++
Sbjct: 956  RQSTIDVLIEDLHTYTFNPPETDGNTFVFAYQLDKEKFRLKVI 998


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 701,637
Number of Sequences: 2352
Number of extensions: 13910
Number of successful extensions: 27
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -