SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY137766-1|AAM94344.1|   78|Anopheles gambiae heat shock protein...    97   4e-22
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            24   4.3  
DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.       24   5.7  

>AY137766-1|AAM94344.1|   78|Anopheles gambiae heat shock protein 70
           protein.
          Length = 78

 Score = 97.5 bits (232), Expect = 4e-22
 Identities = 46/53 (86%), Positives = 49/53 (92%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK   GERNVLIFDL
Sbjct: 8   AYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60



 Score = 29.9 bits (64), Expect = 0.087
 Identities = 12/14 (85%), Positives = 14/14 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG 712
           GGTFDVSILTI++G
Sbjct: 62  GGTFDVSILTIDEG 75


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 24.2 bits (50), Expect = 4.3
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +2

Query: 71   NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 172
            +GK  RS +   +++LL    P REG  H+  Q PG
Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837


>DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.
          Length = 410

 Score = 23.8 bits (49), Expect = 5.7
 Identities = 9/23 (39%), Positives = 11/23 (47%)
 Frame = +2

Query: 191 LCCVHRHRASHRRCRQEPGGDDP 259
           +CC+   R   RR    P  DDP
Sbjct: 322 VCCIESFRRRRRRDAFTPSKDDP 344


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 857,341
Number of Sequences: 2352
Number of extensions: 19001
Number of successful extensions: 73
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 70
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 73
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 76507752
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -