SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF236124-1|AAF68382.1|  107|Anopheles gambiae thioredoxin 1 prot...    36   0.001
AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.    25   3.1  
AJ237664-1|CAB40379.2|   81|Anopheles gambiae putative infection...    25   3.1  
AF119382-1|AAD27585.1|  394|Anopheles gambiae caudal protein hom...    25   3.1  
AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein...    24   5.4  
AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein...    24   5.4  
AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein...    24   5.4  
AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein...    24   5.4  
AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein...    24   5.4  
AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein...    24   5.4  
AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein...    24   5.4  
AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein...    24   5.4  
AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein...    24   5.4  
AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein...    24   5.4  
AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein...    24   5.4  
AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein...    24   5.4  
AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein...    24   5.4  
AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein...    24   5.4  
AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein...    24   5.4  
AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein...    24   5.4  
AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein...    24   5.4  
AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein...    24   5.4  
AJ439353-12|CAD27934.1|  160|Anopheles gambiae putative MLC1 pro...    24   5.4  
U51225-1|AAA96405.1|  692|Anopheles gambiae hexamerin protein.         24   7.1  
AF020872-1|AAC31875.1|  692|Anopheles gambiae hexamerin A protein.     24   7.1  
AF020871-1|AAC31874.1|  692|Anopheles gambiae hexamerin A protein.     24   7.1  
AF020870-1|AAC31873.1|  692|Anopheles gambiae hexamerin A protein.     24   7.1  
Z81292-1|CAB03593.1|  209|Anopheles gambiae GSTD1-6 protein prot...    23   9.4  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            23   9.4  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   9.4  
AY280612-1|AAQ21365.1|  309|Anopheles gambiae carbonic anhydrase...    23   9.4  
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    23   9.4  
AF071160-1|AAC79995.1|  209|Anopheles gambiae glutathione S-tran...    23   9.4  

>AF236124-1|AAF68382.1|  107|Anopheles gambiae thioredoxin 1
           protein.
          Length = 107

 Score = 36.3 bits (80), Expect = 0.001
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +2

Query: 158 EYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           + ++V+F+A WCG CK +AP+  +   K A++
Sbjct: 21  QLVVVDFFATWCGPCKVIAPKLEEFQNKYADK 52



 Score = 29.1 bits (62), Expect = 0.19
 Identities = 12/52 (23%), Positives = 26/52 (50%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           I + KVD  + ++LA  Y +   PT  F +    +    G  A+ + +++++
Sbjct: 53  IVVVKVDVDECEELAAQYNIASMPTFLFIKRKEVVGQFSGANAEKLENFIQQ 104


>AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.
          Length = 1376

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 10/21 (47%), Positives = 16/21 (76%), Gaps = 3/21 (14%)
 Frame = -2

Query: 798  IWNLSPPKESWKPV---SGGE 745
            ++++ PPK+SWK +   SGGE
Sbjct: 1171 VFSVRPPKKSWKMISNLSGGE 1191


>AJ237664-1|CAB40379.2|   81|Anopheles gambiae putative infection
           responsive shortpeptide protein.
          Length = 81

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEY 223
           +V  YAP C  CKS+   Y
Sbjct: 21  MVFAYAPTCARCKSIGARY 39


>AF119382-1|AAD27585.1|  394|Anopheles gambiae caudal protein
           homolog protein.
          Length = 394

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +3

Query: 189 GAATANLWHRNTP-RQQQSWLKKISYQTSES*RNSRT 296
           G+++  +  R TP +    W+KK SYQ+  +   +RT
Sbjct: 178 GSSSPQITPRPTPVKSPYEWMKKQSYQSQPNPGKTRT 214


>AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 80  IIMFYADWCFACMKAANSFKK 100


>AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 80  IIMFYADWCFACMKAANSFKK 100


>AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 82  IIMFYADWCFACMKAANSFKK 102


>AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 82  IIMFYADWCFACMKAANSFKK 102


>AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 85  IIMFYADWCFACMKAANSFKK 105


>AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 85  IIMFYADWCFACMKAANSFKK 105


>AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 97  IIMFYADWCFACMKAANSFKK 117


>AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 97  IIMFYADWCFACMKAANSFKK 117


>AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 79  IIMFYADWCFACMKAANSFKK 99


>AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 79  IIMFYADWCFACMKAANSFKK 99


>AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 167 LVEFYAPWCGHCKSLAPEYAK 229
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AJ439353-12|CAD27934.1|  160|Anopheles gambiae putative MLC1
           protein protein.
          Length = 160

 Score = 24.2 bits (50), Expect = 5.4
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 838 PIFSGIKKVKKXGYLESF 785
           PIFS +KK K+ G  E F
Sbjct: 70  PIFSQVKKEKEQGCFEDF 87


>U51225-1|AAA96405.1|  692|Anopheles gambiae hexamerin protein.
          Length = 692

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -2

Query: 525 WLSSGPKETKYNNSIGIDKFFSLFSRGDLNSRG 427
           W+S    ETKYN+   + +FF  +  G    +G
Sbjct: 65  WVSD---ETKYNDFAQVAEFFDYYKTGAFLEKG 94


>AF020872-1|AAC31875.1|  692|Anopheles gambiae hexamerin A protein.
          Length = 692

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -2

Query: 525 WLSSGPKETKYNNSIGIDKFFSLFSRGDLNSRG 427
           W+S    ETKYN+   + +FF  +  G    +G
Sbjct: 65  WVSD---ETKYNDFAQVAEFFDYYKTGAFLEKG 94


>AF020871-1|AAC31874.1|  692|Anopheles gambiae hexamerin A protein.
          Length = 692

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -2

Query: 525 WLSSGPKETKYNNSIGIDKFFSLFSRGDLNSRG 427
           W+S    ETKYN+   + +FF  +  G    +G
Sbjct: 65  WVSD---ETKYNDFAQVAEFFDYYKTGAFLEKG 94


>AF020870-1|AAC31873.1|  692|Anopheles gambiae hexamerin A protein.
          Length = 692

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = -2

Query: 525 WLSSGPKETKYNNSIGIDKFFSLFSRGDLNSRG 427
           W+S    ETKYN+   + +FF  +  G    +G
Sbjct: 65  WVSD---ETKYNDFAQVAEFFDYYKTGAFLEKG 94


>Z81292-1|CAB03593.1|  209|Anopheles gambiae GSTD1-6 protein
           protein.
          Length = 209

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 5/62 (8%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEF-----YAPWCGHCKSLAPE 220
           A+  L   L  +     N L ++  +    I T E    +F      A W   CK+ AP 
Sbjct: 133 AVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPG 192

Query: 221 YA 226
           YA
Sbjct: 193 YA 194


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -3

Query: 530 GSG*ALVQKKPNTITVLASISSLACSAEVTSTAGGP 423
           GSG  L + +P+T   +A  S      + TS+ G P
Sbjct: 93  GSGHYLARDEPSTSLAVAGGSERRVQRDATSSGGRP 128


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = -3

Query: 530  GSG*ALVQKKPNTITVLASISSLACS-AEVTSTAGGPVFFFSQLMMS 393
            G+  AL+     +  +L + SSL  S   +TS A   +FF ++L MS
Sbjct: 2842 GTWNALMNGVATSSWILMNPSSLISSFVSITSVAAKALFFVAKLTMS 2888


>AY280612-1|AAQ21365.1|  309|Anopheles gambiae carbonic anhydrase
           protein.
          Length = 309

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -2

Query: 201 QWPHHGA*NSTKMYSVVVITVSKLALLKTSTFS 103
           +W  HG   +TKM S VV   + + L+ TS  S
Sbjct: 275 EWDQHGNNFATKMTSNVVFLGAIVLLVITSRLS 307


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 11/38 (28%), Positives = 23/38 (60%)
 Frame = -2

Query: 561  QQLEQLKGKFWLWLSSGPKETKYNNSIGIDKFFSLFSR 448
            ++ E+L+G+F   + +G +   +NN   I++F SL  +
Sbjct: 1027 EEAEELEGQFMFQIFNGERFFAFNNQT-IEQFPSLVKK 1063


>AF071160-1|AAC79995.1|  209|Anopheles gambiae glutathione
           S-transferase protein.
          Length = 209

 Score = 23.4 bits (48), Expect = 9.4
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 5/62 (8%)
 Frame = +2

Query: 56  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEF-----YAPWCGHCKSLAPE 220
           A+  L   L  +     N L ++  +    I T E    +F      A W   CK+ AP 
Sbjct: 133 AVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPG 192

Query: 221 YA 226
           YA
Sbjct: 193 YA 194


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 860,510
Number of Sequences: 2352
Number of extensions: 17934
Number of successful extensions: 91
Number of sequences better than 10.0: 67
Number of HSP's better than 10.0 without gapping: 90
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 91
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 95920632
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -