SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146737-1|AAO12097.1|  119|Anopheles gambiae odorant-binding pr...    25   2.3  
AJ697722-1|CAG26915.1|  119|Anopheles gambiae putative odorant-b...    25   2.3  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    25   2.3  
DQ974162-1|ABJ52802.1|  418|Anopheles gambiae serpin 3 protein.        24   7.1  

>AY146737-1|AAO12097.1|  119|Anopheles gambiae odorant-binding
           protein AgamOBP27 protein.
          Length = 119

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 10/44 (22%), Positives = 21/44 (47%)
 Frame = +1

Query: 151 NRDGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282
           NRD  ++F  +   +++ + +  +   +V PT C   F    C+
Sbjct: 64  NRDTIMRFTNRFVSKEISEKVYNICTDNVTPTYCVTAFDVYQCI 107


>AJ697722-1|CAG26915.1|  119|Anopheles gambiae putative
           odorant-binding protein OBPjj12 protein.
          Length = 119

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 10/44 (22%), Positives = 21/44 (47%)
 Frame = +1

Query: 151 NRDGSLQFEKQPAVRDVEDALTGVDQRDVAPTDCPELFRTADCV 282
           NRD  ++F  +   +++ + +  +   +V PT C   F    C+
Sbjct: 64  NRDTIMRFTNRFVSKEISEKVYNICTDNVTPTYCVTAFDVYQCI 107


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 3/33 (9%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGR---SPGA 745
           G P +P  P  GG  P+    P+P R    PGA
Sbjct: 204 GTPTQPQPPRPGGMYPQPPGVPMPMRPQMPPGA 236


>DQ974162-1|ABJ52802.1|  418|Anopheles gambiae serpin 3 protein.
          Length = 418

 Score = 23.8 bits (49), Expect = 7.1
 Identities = 8/28 (28%), Positives = 19/28 (67%)
 Frame = -2

Query: 461 LI*PTLGLMMSSLFFKASWNVILPPIAS 378
           L+   L +++++++FK SW++  P  A+
Sbjct: 187 LLQDALMMLINTIYFKGSWSIPFPTNAT 214


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 839,646
Number of Sequences: 2352
Number of extensions: 17847
Number of successful extensions: 36
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 34
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 95507181
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -