SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           25   4.2  
AY748837-1|AAV28185.1|   97|Anopheles gambiae cytochrome P450 pr...    24   5.5  
AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.    24   7.3  

>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 24.6 bits (51), Expect = 4.2
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = +3

Query: 291 RCLHAVGSGGTPGWPCDPKNTI 356
           +CLH + +G + GW    +NT+
Sbjct: 16  KCLHPLRTGRSQGWYMHGRNTL 37


>AY748837-1|AAV28185.1|   97|Anopheles gambiae cytochrome P450
           protein.
          Length = 97

 Score = 24.2 bits (50), Expect = 5.5
 Identities = 9/38 (23%), Positives = 19/38 (50%)
 Frame = -2

Query: 498 AYVRPAILRDERSLIPDVERSTSCPTNYCRRIHCRSLR 385
           A  +  + R+ + ++PD   +     +YCR +   +LR
Sbjct: 10  ATAQDRLYREAKKILPDPRENRIAEASYCRAVLKETLR 47


>AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.
          Length = 1036

 Score = 23.8 bits (49), Expect = 7.3
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +3

Query: 24  QVLKYKVK*NEMKMTNLKN*VINWDETKWNGMRWTHNVRDTILD 155
           Q  K KVK  E K   L   ++N DE K    R    + + +LD
Sbjct: 667 QQTKMKVKRQEQKCKELTARLVNVDEEKVKFERSCRTIIEQLLD 710


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 888,307
Number of Sequences: 2352
Number of extensions: 16866
Number of successful extensions: 19
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 97574436
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -