SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY028782-1|AAK32956.1|  501|Anopheles gambiae cytochrome P450 pr...    25   3.7  
AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    24   6.4  
EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    23   8.5  

>AY028782-1|AAK32956.1|  501|Anopheles gambiae cytochrome P450
           protein.
          Length = 501

 Score = 24.6 bits (51), Expect = 3.7
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +1

Query: 148 LLSLIVLAVTLIFWWIFSRRYT 213
           LL L++LAVT   W++  R+YT
Sbjct: 2   LLYLLLLAVTAAIWYV-RRKYT 22


>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
           protein.
          Length = 1077

 Score = 23.8 bits (49), Expect = 6.4
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +2

Query: 590 VIQGLLGKGINLVR-VTQSDPLAVRRFV*RXHP 685
           ++ G L   I++ R V Q DPL++  F+   HP
Sbjct: 632 LVNGSLSPPISIRRSVRQGDPLSMHLFILYLHP 664


>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
           channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 23.4 bits (48), Expect = 8.5
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +1

Query: 187 WWIFSRRYTLRNSVLLM 237
           WW + RR+ L  S+LL+
Sbjct: 9   WWRWRRRHLLTGSLLLL 25


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 705,060
Number of Sequences: 2352
Number of extensions: 12623
Number of successful extensions: 89
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 87
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 89
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 86071221
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -