SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    27   0.64 
AJ271117-1|CAB88872.1|  355|Anopheles gambiae serine protease pr...    24   7.9  

>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 27.5 bits (58), Expect = 0.64
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = +3

Query: 396 QQRSYWFGCEVQQGSRHCHSRRYYPC*AVSSNQSEEV 506
           ++R+YW+  E+ Q   HC   R     A SS Q E++
Sbjct: 268 RRRAYWWTTEIAQCRSHCIEARRKMNRAKSSEQREDL 304


>AJ271117-1|CAB88872.1|  355|Anopheles gambiae serine protease
           protein.
          Length = 355

 Score = 23.8 bits (49), Expect = 7.9
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = -3

Query: 347 VCFCTGMILRTSSFRDGPRKKSMISNSLIGKKTSK 243
           VC  +    RTSSF   P     +++ +IG +T++
Sbjct: 76  VCCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTE 110


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 855,043
Number of Sequences: 2352
Number of extensions: 16564
Number of successful extensions: 46
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 45
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 105430005
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -