SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          26   1.7  
Y17702-1|CAA76822.2|  260|Anopheles gambiae putative gVAG protei...    24   6.9  
X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.     23   9.1  

>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 25.8 bits (54), Expect = 1.7
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = +3

Query: 108  NSTSADSA-LKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRID 245
            +S+  DS  L  GE     R+L+  +   + QR+  KR+D  PDR +
Sbjct: 998  SSSVLDSMDLINGERASIARLLEEHEPEAEPQRKATKRSDSGPDRTE 1044


>Y17702-1|CAA76822.2|  260|Anopheles gambiae putative gVAG protein
           precursor protein.
          Length = 260

 Score = 23.8 bits (49), Expect = 6.9
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 370 SECRINENTKFPSLNTTSYQEP 435
           S+C+   N+KFP L   S +EP
Sbjct: 234 SQCKTGRNSKFPGLCNAS-EEP 254


>X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.
          Length = 696

 Score = 23.4 bits (48), Expect = 9.1
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = -2

Query: 281 ATHSPSSGLGHPVDPI 234
           AT +PS G+G P+ P+
Sbjct: 450 ATLTPSPGIGGPISPL 465


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 894,278
Number of Sequences: 2352
Number of extensions: 18397
Number of successful extensions: 32
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 92199573
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -