SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    36   0.002
AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific tran...    36   0.002
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    36   0.002
AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless male-spe...    36   0.002
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            24   7.0  
AJ439353-4|CAD27926.1|  338|Anopheles gambiae putative hox prote...    24   7.0  
M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           23   9.2  

>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 35.5 bits (78), Expect = 0.002
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  + G     H+AILSACSPYF  +F    H
Sbjct: 78  CDVTLACEKGM-VKAHQAILSACSPYFEQIFVENKH 112


>AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific
           transcription factor FRU-MB protein.
          Length = 759

 Score = 35.5 bits (78), Expect = 0.002
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  + G     H+AILSACSPYF  +F    H
Sbjct: 78  CDVTLACEKGM-VKAHQAILSACSPYFEQIFVENKH 112


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 35.5 bits (78), Expect = 0.002
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  + G     H+AILSACSPYF  +F    H
Sbjct: 30  CDVTLACEKGM-VKAHQAILSACSPYFEQIFVENKH 64


>AY725819-1|AAU50567.1|  569|Anopheles gambiae fruitless
           male-specific zinc-fingerC isoform protein.
          Length = 569

 Score = 35.5 bits (78), Expect = 0.002
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLH 362
           CD  +  + G     H+AILSACSPYF  +F    H
Sbjct: 78  CDVTLACEKGM-VKAHQAILSACSPYFEQIFVENKH 112


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 23.8 bits (49), Expect = 7.0
 Identities = 9/16 (56%), Positives = 13/16 (81%)
 Frame = +3

Query: 192 RSVHVGGSDAGAPSTA 239
           RS+ +GGS AG PS++
Sbjct: 732 RSIGLGGSGAGGPSSS 747


>AJ439353-4|CAD27926.1|  338|Anopheles gambiae putative hox protein
           protein.
          Length = 338

 Score = 23.8 bits (49), Expect = 7.0
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -1

Query: 268 TIASQADDTRAVDGAPASLPPTCTDRFPDP 179
           ++ S ++   A  GA AS PPT     P P
Sbjct: 149 SLTSGSNVAAAAAGASASTPPTIPSASPSP 178


>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 23.4 bits (48), Expect = 9.2
 Identities = 13/23 (56%), Positives = 14/23 (60%)
 Frame = +2

Query: 317  SLQPILPGTVHNNSSFSGAKRRI 385
            SLQ  L G+  N SSF  A RRI
Sbjct: 1048 SLQDFLMGSQDNWSSFCEAARRI 1070


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 902,056
Number of Sequences: 2352
Number of extensions: 18498
Number of successful extensions: 52
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 50
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 93853377
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -