SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.          25   2.3  
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.          25   2.3  
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.          25   2.3  
M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    25   3.0  
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.           25   3.0  
M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    23   9.3  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 15/73 (20%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +1

Query: 385 VAAGTGEFEAGISKNGQTREHALLAFTLGVKQ-LIVGVNKMDSLNHHTVSPDLRKSRRKY 561
           V  G G+ ++ +    Q++   +L     ++  ++   + M+ + HHT   +LR +  ++
Sbjct: 44  VMVGMGQKDSYVGDEAQSKR-GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 102

Query: 562 PHTSRRLGYNPAA 600
           P        NP A
Sbjct: 103 PVLLTEAPLNPKA 115


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 15/73 (20%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +1

Query: 385 VAAGTGEFEAGISKNGQTREHALLAFTLGVKQ-LIVGVNKMDSLNHHTVSPDLRKSRRKY 561
           V  G G+ ++ +    Q++   +L     ++  ++   + M+ + HHT   +LR +  ++
Sbjct: 44  VMVGMGQKDSYVGDEAQSKR-GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 102

Query: 562 PHTSRRLGYNPAA 600
           P        NP A
Sbjct: 103 PVLLTEAPLNPKA 115


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 15/73 (20%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +1

Query: 385 VAAGTGEFEAGISKNGQTREHALLAFTLGVKQ-LIVGVNKMDSLNHHTVSPDLRKSRRKY 561
           V  G G+ ++ +    Q++   +L     ++  ++   + M+ + HHT   +LR +  ++
Sbjct: 44  VMVGMGQKDSYVGDEAQSKR-GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 102

Query: 562 PHTSRRLGYNPAA 600
           P        NP A
Sbjct: 103 PVLLTEAPLNPKA 115


>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 25.0 bits (52), Expect = 3.0
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 516 PPYSEPRFEEIKKEVSSYIKKIGLQPSCCRFR 611
           PP+S      +KK+   Y+++  L  S   FR
Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNFR 364


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score = 25.0 bits (52), Expect = 3.0
 Identities = 16/71 (22%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = +1

Query: 385 VAAGTGEFEAGISKNGQTREHALLAFTLGVKQ-LIVGVNKMDSLNHHTVSPDLRKSRRKY 561
           V  G G  +A +    Q++   +L     ++  +I   + M+ + HHT   +LR +  ++
Sbjct: 44  VMVGMGNKDAYVGDEAQSKR-GILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEH 102

Query: 562 PHTSRRLGYNP 594
           P        NP
Sbjct: 103 PVLLTEAPLNP 113


>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 23.4 bits (48), Expect = 9.3
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = +3

Query: 453 ARFHPRCQTAHRRSKQNGFTEPPYS 527
           ARF P   T+HR S  N  +  P S
Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKS 368


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 951,741
Number of Sequences: 2352
Number of extensions: 20307
Number of successful extensions: 33
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 94266828
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -