SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY505417-1|AAR90328.1|  206|Anopheles gambiae superoxide dismuta...    26   1.8  
DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domai...    25   3.1  
M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           25   4.1  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    24   7.2  
AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.         24   7.2  
AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.         24   7.2  
AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.         24   7.2  
AY578809-1|AAT07314.1|  358|Anopheles gambiae Sloan-Kettering In...    23   9.5  
AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.         23   9.5  

>AY505417-1|AAR90328.1|  206|Anopheles gambiae superoxide dismutase
           1 protein.
          Length = 206

 Score = 25.8 bits (54), Expect = 1.8
 Identities = 10/36 (27%), Positives = 20/36 (55%)
 Frame = -3

Query: 577 LNREGQNLDSHSSDVRRSHFAYQPANWSLSLYTSST 470
           LNR+ QN+++   +++ +  A Q + W+   Y   T
Sbjct: 128 LNRDFQNMENFKKEMKAAAVAVQGSGWAWLGYNKKT 163


>DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 285

 Score = 25.0 bits (52), Expect = 3.1
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +1

Query: 52  VIVLVVKCSVCIVKVTVKGFKMG 120
           V+++   CS+C  + TVK +  G
Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTG 157


>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 24.6 bits (51), Expect = 4.1
 Identities = 12/44 (27%), Positives = 23/44 (52%)
 Frame = +3

Query: 522  WLRRTSEEWESRFCPSRLRTSTTMSSIWASLGKFATANVKRDAE 653
            +L  + + W S FC +  R +TT+   W +  +   A+ + +AE
Sbjct: 1052 FLMGSQDNWSS-FCEAARRITTTLQRDWDTEREQRAASNREEAE 1094


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
            structural protein protein.
          Length = 1645

 Score = 23.8 bits (49), Expect = 7.2
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -2

Query: 176  PKQPPETISASLGPTVWMLPILNPFTVT 93
            P QPPET++ +    + + P + P T T
Sbjct: 1471 PVQPPETLTPAGSVAITVEPSVPPATTT 1498


>AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 23.8 bits (49), Expect = 7.2
 Identities = 12/40 (30%), Positives = 16/40 (40%)
 Frame = -2

Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90
           H  T  +  V PK    T + ++ PT    P   P   TF
Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151


>AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 23.8 bits (49), Expect = 7.2
 Identities = 12/40 (30%), Positives = 16/40 (40%)
 Frame = -2

Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90
           H  T  +  V PK    T + ++ PT    P   P   TF
Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151


>AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 23.8 bits (49), Expect = 7.2
 Identities = 12/40 (30%), Positives = 16/40 (40%)
 Frame = -2

Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90
           H  T  +  V PK    T + ++ PT    P   P   TF
Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151


>AY578809-1|AAT07314.1|  358|Anopheles gambiae Sloan-Kettering
           Institute proto-oncogeneproduct protein.
          Length = 358

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 10/43 (23%), Positives = 20/43 (46%)
 Frame = +2

Query: 716 NGRQNIRLTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFW 844
           N R  I +    + ++   ++ ++     R +   L+ ERAFW
Sbjct: 290 NWRSYIHVAESEKNREEHAQVLDKIWLKEREIEQELEAERAFW 332


>AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 23.4 bits (48), Expect = 9.5
 Identities = 12/40 (30%), Positives = 16/40 (40%)
 Frame = -2

Query: 209 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 90
           H  T  +  V PK    T + ++ PT    P   P   TF
Sbjct: 112 HTITRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,010,904
Number of Sequences: 2352
Number of extensions: 23449
Number of successful extensions: 51
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 48
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96747534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -