SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced ...    25   1.7  
AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         24   5.3  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    23   9.2  

>AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced
           homeotic protein protein.
          Length = 372

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = -1

Query: 676 EGVTKXGXGGTXXRCSAPPPTVPMWL 599
           EG +  G GG+  +   PPP +  W+
Sbjct: 239 EGGSSQGGGGSSSKKGGPPPHIYPWM 264


>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 8/23 (34%), Positives = 15/23 (65%)
 Frame = +1

Query: 187 EHLAVLRCQQPMLNHHAAHNAQD 255
           E ++V    +P+ NH A+H+A +
Sbjct: 389 EEISVEEVDEPVSNHSASHSASE 411


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -2

Query: 228 VQHGLLAAQHGQVFPGRDRQRQVLECFYSR 139
           + H LL +     FP     R +L CF+ R
Sbjct: 176 IPHKLLKSYSAGSFPDAPETRCLLRCFFLR 205


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 654,307
Number of Sequences: 2352
Number of extensions: 11060
Number of successful extensions: 68
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70668195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -