SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    25   4.0  
AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein ...    24   5.3  
AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript...    24   5.3  

>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 24.6 bits (51), Expect = 4.0
 Identities = 11/24 (45%), Positives = 12/24 (50%)
 Frame = -1

Query: 584 CRYPVPSRRVRNARDLPWRRRRCT 513
           CR P   RR R+ R   W R R T
Sbjct: 271 CRSPPARRRSRSTRPTSWPRSRPT 294


>AY939827-1|AAY18208.1|  680|Anopheles gambiae CTCF-like protein
           protein.
          Length = 680

 Score = 24.2 bits (50), Expect = 5.3
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 3/72 (4%)
 Frame = +2

Query: 236 ISHNLCYSKDDT--KDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEE-ENTEKRSQNLDE 406
           I H   +  + T  K+ +   + + KK+Q  +  E YK  +  + EE E  E+     D+
Sbjct: 436 IRHMAMHDPESTVSKEMEALREGRQKKVQITFEEEIYKGEEDYEGEEDEEDEEDEYEGDD 495

Query: 407 AKKILLQEDPSL 442
            ++    ED  L
Sbjct: 496 TEEDEEDEDDEL 507


>AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1009

 Score = 24.2 bits (50), Expect = 5.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 487 WSEDMHQRWVHRL 525
           W E +H RW +RL
Sbjct: 858 WDESVHGRWTYRL 870


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 918,620
Number of Sequences: 2352
Number of extensions: 18333
Number of successful extensions: 26
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 93853377
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -