SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         185   1e-48
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         185   1e-48
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         185   1e-48
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          177   5e-46
AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.         28   0.061
AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.         28   0.061
AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.         28   0.061
AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.         28   0.080
AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.           29   0.24 
AY341184-1|AAR13748.1|  187|Anopheles gambiae GNBP A1 protein.         29   0.24 
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    29   0.24 
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           27   0.55 
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           27   0.73 
AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.           25   2.2  
AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.           25   2.2  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    25   2.2  
AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    25   2.9  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           25   3.9  
DQ013245-1|AAY34441.1|  487|Anopheles gambiae adrenodoxin reduct...    24   5.1  
U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.         24   6.8  
U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.         24   6.8  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    23   9.0  
CR954256-8|CAJ14149.1|  247|Anopheles gambiae putative signal pe...    23   9.0  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   9.0  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  185 bits (451), Expect = 1e-48
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 4e-32
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 7e-32
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  185 bits (451), Expect = 1e-48
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 4e-32
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 7e-32
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  185 bits (451), Expect = 1e-48
 Identities = 85/85 (100%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFNTPAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNTPAMYVAIQAVLSL 143



 Score =  130 bits (315), Expect = 4e-32
 Identities = 65/78 (83%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  130 bits (313), Expect = 7e-32
 Identities = 59/62 (95%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  177 bits (430), Expect = 5e-46
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NRE
Sbjct: 59  AQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETF  PA+YVAIQAVLSL
Sbjct: 119 KMTQIMFETFAAPAVYVAIQAVLSL 143



 Score =  129 bits (312), Expect = 9e-32
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+VLDSGDGVSHTVPIYEGYALPHAILR+D +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGVVLDSGDGVSHTVPIYEGYALPHAILRMDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  121 bits (291), Expect = 3e-29
 Identities = 53/62 (85%), Positives = 58/62 (93%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDE +
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 28.3 bits (60), Expect(2) = 0.061
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = +3

Query: 546 PATVSPTPCPSTRDT-HSPTPSCVWTLAGRDSQTTS*RFSP 665
           P T +P PCP T  T +   P+C   L   D+      F+P
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTCAGKLLFEDTFEQGSSFAP 176



 Score = 21.0 bits (42), Expect(2) = 0.061
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 378 EEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++H V  T+A + PK+     T  +  T  TP
Sbjct: 110 KKHTVTRTKATVAPKSTTTTTTTTVKPTTTTP 141


>AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 28.3 bits (60), Expect(2) = 0.061
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = +3

Query: 546 PATVSPTPCPSTRDT-HSPTPSCVWTLAGRDSQTTS*RFSP 665
           P T +P PCP T  T +   P+C   L   D+      F+P
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTCAGKLLFEDTFEQGSSFAP 176



 Score = 21.0 bits (42), Expect(2) = 0.061
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 378 EEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++H V  T+A + PK+     T  +  T  TP
Sbjct: 110 KKHTVTRTKATVAPKSTTTTTTTTVKPTTTTP 141


>AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 28.3 bits (60), Expect(2) = 0.061
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = +3

Query: 546 PATVSPTPCPSTRDT-HSPTPSCVWTLAGRDSQTTS*RFSP 665
           P T +P PCP T  T +   P+C   L   D+      F+P
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTCAGKLLFEDTFEQGSSFAP 176



 Score = 21.0 bits (42), Expect(2) = 0.061
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 378 EEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++H V  T+A + PK+     T  +  T  TP
Sbjct: 110 KKHTVTRTKATVAPKSTTTTTTTTVKPTTTTP 141


>AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 28.3 bits (60), Expect(2) = 0.080
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)
 Frame = +3

Query: 546 PATVSPTPCPSTRDT-HSPTPSCVWTLAGRDSQTTS*RFSP 665
           P T +P PCP T  T +   P+C   L   D+      F+P
Sbjct: 136 PTTTTPPPCPPTLTTFNGGQPTCAGKLLFEDTFEQGSSFAP 176



 Score = 20.6 bits (41), Expect(2) = 0.080
 Identities = 9/32 (28%), Positives = 16/32 (50%)
 Frame = +3

Query: 378 EEHPVLLTEAPLNPKANREKMTQIMFETFNTP 473
           ++H +  T+A + PK+     T  +  T  TP
Sbjct: 110 KKHTITRTKATVAPKSTTTTTTTTVKPTTTTP 141


>AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 28.7 bits (61), Expect = 0.24
 Identities = 20/66 (30%), Positives = 26/66 (39%), Gaps = 6/66 (9%)
 Frame = +3

Query: 516 PVVPPVSCWT-PATVSPTPCPSTRDTHS---PTPSCVWTLAGRDSQTTS*RFSPSAAT-- 677
           P     + WT P   + TP P+T  T S   P P    T    D   T+   +P+  T  
Sbjct: 181 PTTTTTTVWTDPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHAPTTTTTW 240

Query: 678 RSLPTP 695
             LP P
Sbjct: 241 SDLPPP 246


>AY341184-1|AAR13748.1|  187|Anopheles gambiae GNBP A1 protein.
          Length = 187

 Score = 28.7 bits (61), Expect = 0.24
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 6/58 (10%)
 Frame = +3

Query: 510 TRPVVPPVSCWT-----PATVSPTPCPSTRDT-HSPTPSCVWTLAGRDSQTTS*RFSP 665
           T+  V P S  T     P T +P PCP T  T +   P+C   L   D+      F+P
Sbjct: 117 TKATVAPKSTTTTTTVKPTTTTPPPCPPTLTTFNGGQPTCAGKLLFEDTFEQGSSFAP 174


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 28.7 bits (61), Expect = 0.24
 Identities = 20/94 (21%), Positives = 31/94 (32%)
 Frame = +3

Query: 339 WHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRP 518
           W  T   E     +      T AP  P    +         +  P  + A     + +  
Sbjct: 118 WITTTTTEATTTTKFPTTTTTSAPTTPSQWTDPTITTTTPVWTDPTTWSAPTTTTTWSDQ 177

Query: 519 VVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWT 620
             PP +  T     PT   +T  TH+PT +  W+
Sbjct: 178 PPPPTTTTTTVWTDPT---ATTTTHAPTTTTTWS 208



 Score = 25.4 bits (53), Expect = 2.2
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWT 620
           PP +  T   + PT   +T  TH+PT +  W+
Sbjct: 213 PPPTTTTTVWIDPT---ATTTTHAPTTTTTWS 241


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 27.5 bits (58), Expect = 0.55
 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 4/58 (6%)
 Frame = +3

Query: 516 PVVPPVSCWT-PATVSPTPCPSTRDTHS---PTPSCVWTLAGRDSQTTS*RFSPSAAT 677
           P     + WT P   + TP P+T  T S   P P    T    D   T+   +P+  T
Sbjct: 181 PTTTTTTVWTDPTATTTTPAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHAPTTTT 238



 Score = 25.4 bits (53), Expect = 2.2
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWT 620
           PP +  T   + PT   +T  TH+PT +  W+
Sbjct: 213 PPPTTTTTVWIDPT---ATTTTHAPTTTTTWS 241


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 27.1 bits (57), Expect = 0.73
 Identities = 17/74 (22%), Positives = 27/74 (36%)
 Frame = +3

Query: 399 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPS 578
           T AP  P    +         +  P  + A     + +    PP +  T     PT   +
Sbjct: 138 TSAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPRPPTTTTTTVWTDPT---A 194

Query: 579 TRDTHSPTPSCVWT 620
           T  TH+PT +  W+
Sbjct: 195 TTTTHAPTTTTTWS 208



 Score = 23.4 bits (48), Expect = 9.0
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = +3

Query: 543 TPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRS-LPTP 695
           T  T +PT   +  D   P P+   T+    + TT+    P+  T S LP P
Sbjct: 195 TTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPPTTTTWSDLPPP 246


>AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 25.4 bits (53), Expect = 2.2
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWT 620
           PP +  T   + PT   +T  TH+PT +  W+
Sbjct: 213 PPPTTTTTVWIDPT---ATTTTHAPTTTTTWS 241


>AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 25.4 bits (53), Expect = 2.2
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPTPSCVWT 620
           PP +  T   + PT   +T  TH+PT +  W+
Sbjct: 212 PPPTTTTTVWIDPT---ATTTTHAPTTTTTWS 240


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 25.4 bits (53), Expect = 2.2
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = +3

Query: 189 GKAPPSGRDGRYGTEGLLCRR*AQSKRGILTLK 287
           G+  P GRDG +G  GL  ++  +   G+  LK
Sbjct: 344 GQPGPRGRDGNFGPVGLPGQKGDRGSEGLHGLK 376


>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 25.0 bits (52), Expect = 2.9
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = +1

Query: 571 AHLRGIRTPPRHPASGL*PVATHRLPHEDS 660
           +HLRG RTPP      L  + T   P  +S
Sbjct: 385 SHLRGSRTPPELDREVLERIVTDLFPDHNS 414


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.6 bits (51), Expect = 3.9
 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 3/101 (2%)
 Frame = +3

Query: 399 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPS 578
           T AP  P    +         +  P  + A     + +    PP    T  T   T   +
Sbjct: 138 TSAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPRPPT---TTTTTVWTDSTA 194

Query: 579 TRDTHSPTPSCVWT--LAGRDSQTTS*RFSPSAATRS-LPT 692
           T  TH+PT +  W+       + TT+    P+A T + +PT
Sbjct: 195 TTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPT 235


>DQ013245-1|AAY34441.1|  487|Anopheles gambiae adrenodoxin reductase
           protein.
          Length = 487

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 14/49 (28%), Positives = 26/49 (53%)
 Frame = +2

Query: 602 AILRLDFSRSRLTDYLMKILTERGYSFITNAXREIRS*TFKEKLCYVGS 748
           +I  L   R R+T+ ++K L E+  + +  A R  +   F+  + +VGS
Sbjct: 258 SIPNLPRPRKRITELMVKSLAEQAPNNVPPAGRCFQPIFFRSPVNFVGS 306


>U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.8 bits (49), Expect = 6.8
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%)
 Frame = +3

Query: 558 SPTPCPS-TRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           SPT   + T  T SP P+C  T +   +   S   SP+    S+  P
Sbjct: 24  SPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMSVVVP 70


>U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.8 bits (49), Expect = 6.8
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%)
 Frame = +3

Query: 558 SPTPCPS-TRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
           SPT   + T  T SP P+C  T +   +   S   SP+    S+  P
Sbjct: 24  SPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMSVVVP 70


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 11/37 (29%), Positives = 16/37 (43%)
 Frame = +2

Query: 413 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAYASGR 523
           QP    ++  P H ++  H  H   H S+    AS R
Sbjct: 168 QPSSYHQQQHPGHSQHHHHHHHHHPHHSQQQHSASPR 204


>CR954256-8|CAJ14149.1|  247|Anopheles gambiae putative signal
           peptidase protein.
          Length = 247

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 11/25 (44%), Positives = 12/25 (48%)
 Frame = -1

Query: 637 ESRPAKVQTQDGVGECVSLVDGHGV 563
           E   AK Q QDG G      +G GV
Sbjct: 157 EEAQAKQQQQDGTGRVAMSGEGRGV 181


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 9.0
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 76  FKMCDEEVAALVVDNGSGMC 135
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 947,972
Number of Sequences: 2352
Number of extensions: 22063
Number of successful extensions: 114
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 113
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 90959220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -