SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30134.Seq
         (882 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    26   1.7  
Z22930-4|CAA80516.1|  267|Anopheles gambiae Trypsinogen precurso...    25   2.3  
AY752894-1|AAV30068.1|  156|Anopheles gambiae peroxidase 2 protein.    25   2.3  
AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    25   4.0  
AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced ...    25   4.0  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            23   9.3  

>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 25.8 bits (54), Expect = 1.7
 Identities = 13/42 (30%), Positives = 17/42 (40%)
 Frame = -3

Query: 412 LSRHETASSSHRVANVXPVPAASKAHTGPAGGATHRPAHSGG 287
           +SR     SS+R A     P       G  G   H+P + GG
Sbjct: 13  MSRSSYTRSSYRSAYYGGPPEIGGTGAGALGSQQHQPPYGGG 54


>Z22930-4|CAA80516.1|  267|Anopheles gambiae Trypsinogen precursor
           of ANTRYP7 protein.
          Length = 267

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 11/20 (55%), Positives = 11/20 (55%)
 Frame = -2

Query: 290 RRHPLADPRSDQSPGALISG 231
           RRHPL  PRS    G  I G
Sbjct: 25  RRHPLVQPRSPHGSGHRIVG 44


>AY752894-1|AAV30068.1|  156|Anopheles gambiae peroxidase 2 protein.
          Length = 156

 Score = 25.4 bits (53), Expect = 2.3
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = -2

Query: 290 RRHPLADPRSDQSPGALISGALTSLTLPNLVGMNGR 183
           R + L DPR++Q+P AL+S A+  L   N+V    R
Sbjct: 31  RLYLLGDPRTNQNP-ALLSFAILFLRWHNVVAKRVR 65


>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 24.6 bits (51), Expect = 4.0
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = -3

Query: 331 GPAGGATHRPAHSGGGTPSRTLARTSHP 248
           G   G   RPA+SG   PS    +T  P
Sbjct: 100 GDRNGDGGRPAYSGNSDPSMDQVKTDKP 127


>AF080564-1|AAC31944.1|  372|Anopheles gambiae Sex combs reduced
           homeotic protein protein.
          Length = 372

 Score = 24.6 bits (51), Expect = 4.0
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +3

Query: 159 MDKSRLRQSTVHSNEIGERQRSQRTGYES 245
           M +  + QSTV++N   +RQR+  T Y++
Sbjct: 264 MKRVHIGQSTVNANGETKRQRTSYTRYQT 292


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 23.4 bits (48), Expect = 9.3
 Identities = 14/41 (34%), Positives = 18/41 (43%)
 Frame = -2

Query: 308 PPCTQRRRHPLADPRSDQSPGALISGALTSLTLPNLVGMNG 186
           PP       P+  P S  + G L   A +   LPNL+G  G
Sbjct: 581 PPPAPPPPPPMGPPPSPLAGGPLGGPAGSRPPLPNLLGFGG 621


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 932,474
Number of Sequences: 2352
Number of extensions: 19139
Number of successful extensions: 36
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 94680279
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -