SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    26   0.96 
AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript...    26   0.96 
DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.       24   3.9  
AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.      24   3.9  
U50474-1|AAA93476.1|   62|Anopheles gambiae protein ( Anopheles ...    24   5.1  
EF426178-1|ABO26421.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426177-1|ABO26420.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426176-1|ABO26419.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426174-1|ABO26417.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426173-1|ABO26416.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426172-1|ABO26415.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426171-1|ABO26414.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426170-1|ABO26413.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426169-1|ABO26412.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426168-1|ABO26411.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426167-1|ABO26410.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426166-1|ABO26409.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426165-1|ABO26408.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426164-1|ABO26407.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426163-1|ABO26406.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426162-1|ABO26405.1|  155|Anopheles gambiae unknown protein.         24   5.1  
EF426161-1|ABO26404.1|  155|Anopheles gambiae unknown protein.         24   5.1  
AF364132-2|AAL35509.1|  411|Anopheles gambiae putative odorant r...    24   5.1  
EF426175-1|ABO26418.1|  155|Anopheles gambiae unknown protein.         23   6.7  
AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenin...    23   6.7  
EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.         23   8.9  
EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.         23   8.9  
DQ370036-1|ABD18597.1|  103|Anopheles gambiae putative TIL domai...    23   8.9  
AY062432-1|AAL47188.1|  391|Anopheles gambiae putative odorant r...    23   8.9  

>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
            channel alpha subunitprotein.
          Length = 2139

 Score = 26.2 bits (55), Expect = 0.96
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +2

Query: 479  GNGISEGMGGQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDD 625
            G G S+G+ G  + N  +V   + P E P +  D  P+   T+ L   D
Sbjct: 2067 GGGKSKGIIGSTQANIGIVDSNISPKESPDSIGD--PQGRQTAVLVESD 2113


>AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1168

 Score = 26.2 bits (55), Expect = 0.96
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -1

Query: 442  SGAVTENVASPLVASLPPKTAYGPPGP 362
            +G V E   SP V  +PP++   PP P
Sbjct: 1094 TGEVEEEEVSPPVPPIPPRSRRLPPSP 1120


>DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.
          Length = 410

 Score = 24.2 bits (50), Expect = 3.9
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 479 GNGISEGMGGQFRENYDLVGRLLRPGE-EPRNYSDEE 586
           GNGI    G +F E YD + + L   E +P ++  +E
Sbjct: 44  GNGIFSQKGTKFDERYDKLAKDLYKSELKPLDFVGDE 80


>AY578811-1|AAT07316.1|  565|Anopheles gambiae thickveins protein.
          Length = 565

 Score = 24.2 bits (50), Expect = 3.9
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +2

Query: 518 ENYDLVGRLLRPGEEPRNYSDEEPEEADTSAL 613
           +N DL  + L+P   PR  +  EP  AD +++
Sbjct: 150 DNEDLCNQDLQPPYSPRTTTTPEPPLADPNSM 181


>U50474-1|AAA93476.1|   62|Anopheles gambiae protein ( Anopheles
           gambiae putativetrypsin-like enzyme precursor, mRNA,
           partial cds. ).
          Length = 62

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%)
 Frame = +2

Query: 44  PRIKWIHHQRLKMCK-PNTVAFLRP 115
           P ++WIH  R+++   P T A  RP
Sbjct: 37  PPVRWIHRYRVRISDVPPTPALPRP 61


>EF426178-1|ABO26421.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426177-1|ABO26420.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426176-1|ABO26419.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426174-1|ABO26417.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426173-1|ABO26416.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426172-1|ABO26415.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426171-1|ABO26414.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426170-1|ABO26413.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426169-1|ABO26412.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426168-1|ABO26411.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426167-1|ABO26410.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426166-1|ABO26409.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426165-1|ABO26408.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426164-1|ABO26407.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426163-1|ABO26406.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426162-1|ABO26405.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>EF426161-1|ABO26404.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 370 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           +GH LFL  E  Q+  P  +S + K T+
Sbjct: 59  MGHSLFLPAESRQQLEPACVSVYAKGTV 86


>AF364132-2|AAL35509.1|  411|Anopheles gambiae putative odorant
           receptor Or3 protein.
          Length = 411

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +1

Query: 358 STVPVGHMLFLEEEM 402
           ST PV H+L LEEE+
Sbjct: 177 STEPVEHVLHLEEEL 191


>EF426175-1|ABO26418.1|  155|Anopheles gambiae unknown protein.
          Length = 155

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +1

Query: 373 GHMLFLEEEMPQEDSPRSLSQHLKRTM 453
           GH LFL  E  Q+  P  +S + K T+
Sbjct: 60  GHSLFLPAESRQQLEPACVSVYAKGTV 86


>AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenine
           transaminase protein.
          Length = 396

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +3

Query: 291 QEGGRVLMAVNG-WIFDVTRGNRFYG 365
           +EG RVL+AVNG W       +  YG
Sbjct: 91  EEGDRVLIAVNGIWAERAVEMSERYG 116


>EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 420 WRVLLWHLFLQKQHM 376
           W  +LWHLF + +H+
Sbjct: 26  WWWVLWHLFHEYEHI 40


>DQ370036-1|ABD18597.1|  103|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 103

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 8/27 (29%), Positives = 15/27 (55%)
 Frame = +2

Query: 338 CD*RESVLRSRWAICCFWRKRCHKRTR 418
           C  +++ +R      C W K+C +RT+
Sbjct: 72  CFCKKNYVRRAIGGSCIWAKKCPRRTQ 98


>AY062432-1|AAL47188.1|  391|Anopheles gambiae putative odorant
           receptor Or5 protein.
          Length = 391

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 9/14 (64%), Positives = 12/14 (85%)
 Frame = +1

Query: 361 TVPVGHMLFLEEEM 402
           +VPV H+L LEEE+
Sbjct: 159 SVPVEHVLHLEEEL 172


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 733,936
Number of Sequences: 2352
Number of extensions: 14760
Number of successful extensions: 96
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 95
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 96
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68577420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -