SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.    49   2e-07
AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.    49   2e-07
AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.    49   2e-07
AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.    49   2e-07
U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles ...    27   0.42 
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    25   2.3  
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    24   5.2  
DQ974174-1|ABJ52814.1|  391|Anopheles gambiae serpin 18 protein.       23   6.9  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    23   6.9  
AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein p...    23   6.9  
M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.              23   9.1  

>AY334011-1|AAR01136.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 48.8 bits (111), Expect = 2e-07
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 24  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 73



 Score = 36.7 bits (81), Expect = 7e-04
 Identities = 23/83 (27%), Positives = 37/83 (44%)
 Frame = +3

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY 620
           HYTEG E++++ LDV+R+E E     +   +T +              +   +  P  + 
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60

Query: 621 *PFQSFQVPECRICVVEPYNTTL 689
             +     P+    VVEPYN TL
Sbjct: 61  NTYSVVPSPKVSDTVVEPYNATL 83


>AY334010-1|AAR01135.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 48.8 bits (111), Expect = 2e-07
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 24  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 73



 Score = 36.7 bits (81), Expect = 7e-04
 Identities = 23/83 (27%), Positives = 37/83 (44%)
 Frame = +3

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY 620
           HYTEG E++++ LDV+R+E E     +   +T +              +   +  P  + 
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60

Query: 621 *PFQSFQVPECRICVVEPYNTTL 689
             +     P+    VVEPYN TL
Sbjct: 61  NTYSVVPSPKVSDTVVEPYNATL 83


>AY334009-1|AAR01134.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 48.8 bits (111), Expect = 2e-07
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 24  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 73



 Score = 36.7 bits (81), Expect = 7e-04
 Identities = 23/83 (27%), Positives = 37/83 (44%)
 Frame = +3

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY 620
           HYTEG E++++ LDV+R+E E     +   +T +              +   +  P  + 
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60

Query: 621 *PFQSFQVPECRICVVEPYNTTL 689
             +     P+    VVEPYN TL
Sbjct: 61  NTYSVVPSPKVSDTVVEPYNATL 83


>AY334008-1|AAR01133.1|  188|Anopheles gambiae beta-tubulin protein.
          Length = 188

 Score = 48.8 bits (111), Expect = 2e-07
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ T+SV PSP+VSD
Sbjct: 24  DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSD 73



 Score = 36.7 bits (81), Expect = 7e-04
 Identities = 23/83 (27%), Positives = 37/83 (44%)
 Frame = +3

Query: 441 HYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY 620
           HYTEG E++++ LDV+R+E E     +   +T +              +   +  P  + 
Sbjct: 1   HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60

Query: 621 *PFQSFQVPECRICVVEPYNTTL 689
             +     P+    VVEPYN TL
Sbjct: 61  NTYSVVPSPKVSDTVVEPYNATL 83


>U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles
           gambiae putativetubulin alpha chain mRNA, complete cds.
           ).
          Length = 91

 Score = 27.5 bits (58), Expect = 0.42
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWE 195
           MRE I++ VG  G QIG   W+
Sbjct: 1   MRECISVHVGQAGVQIGNPCWD 22


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = +2

Query: 458 RDSGVCFRCHSKGS*GLDCLQVFRC 532
           R  G+CF C  KG    +C   + C
Sbjct: 372 RKHGLCFNCLRKGHSARECRSTYVC 396


>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative
           cell-adhesion protein protein.
          Length = 1881

 Score = 23.8 bits (49), Expect = 5.2
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = +2

Query: 308 SSHGSYRLEAGHDGRGEVG--TLRMPIQTGQFRLRTKLCGQQLGEGTLH 448
           ++H +YR++ G DGR  +G  T  + I  G       L    LG G+ +
Sbjct: 774 NNHVTYRIQQGGDGRFVIGASTGEISITHGASLDPNLLAPDALGSGSTY 822


>DQ974174-1|ABJ52814.1|  391|Anopheles gambiae serpin 18 protein.
          Length = 391

 Score = 23.4 bits (48), Expect = 6.9
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 199 SPPRTFRRFGFHKNRP 152
           +PP T   F FH NRP
Sbjct: 347 APPDTPSEFEFHANRP 362


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.4 bits (48), Expect = 6.9
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 372 GCLFRPDNFVYGQ 410
           GC +RP NF YG+
Sbjct: 254 GCPWRPPNFKYGR 266


>AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein
           protein.
          Length = 541

 Score = 23.4 bits (48), Expect = 6.9
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 470 VCFRCHSKGS*GLDCLQVFRC 532
           +C RC S+G    DC    +C
Sbjct: 499 LCIRCGSEGHKARDCSSYVKC 519


>M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.
          Length = 613

 Score = 23.0 bits (47), Expect = 9.1
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 470 VCFRCHSKGS*GLDCLQVFRC 532
           VC RC  +G     C++  RC
Sbjct: 573 VCIRCGQEGHKAGTCMEEIRC 593


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 715,657
Number of Sequences: 2352
Number of extensions: 15073
Number of successful extensions: 87
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 79
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70250040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -