SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30122.Seq
         (669 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z49815-1|CAA89969.1|  237|Anopheles gambiae serine proteinase pr...    24   5.0  
AY146758-1|AAO12073.1|  289|Anopheles gambiae odorant-binding pr...    23   6.6  
AJ618930-1|CAF02010.2|  273|Anopheles gambiae odorant-binding pr...    23   6.6  
AF393485-1|AAL60410.1|  289|Anopheles gambiae odorant binding pr...    23   6.6  
AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase...    23   6.6  
DQ518577-1|ABF66619.1|  318|Anopheles gambiae putative secreted ...    23   8.7  
AY146755-1|AAO12070.1|  320|Anopheles gambiae odorant-binding pr...    23   8.7  
AY146754-1|AAO12069.1|  334|Anopheles gambiae odorant-binding pr...    23   8.7  

>Z49815-1|CAA89969.1|  237|Anopheles gambiae serine proteinase
           protein.
          Length = 237

 Score = 23.8 bits (49), Expect = 5.0
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = -3

Query: 565 MLLEVIGIRCPLSLANPRLILTHGHSLSWGIPKQCKARRY 446
           MLL      C  SL N R I+T  H +    P+Q  A+ Y
Sbjct: 17  MLLYRGAFYCGGSLINDRYIVTAAHCVLSFTPQQLLAKLY 56


>AY146758-1|AAO12073.1|  289|Anopheles gambiae odorant-binding
           protein AgamOBP30 protein.
          Length = 289

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 119 ERGSSH*EITGYAKEAFFCHQEEEGNL 199
           +R + H E    A E+F C+ E  GNL
Sbjct: 135 DRPAPHDEACERAYESFRCYYEHYGNL 161


>AJ618930-1|CAF02010.2|  273|Anopheles gambiae odorant-binding
           protein OBPjj83c protein.
          Length = 273

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 119 ERGSSH*EITGYAKEAFFCHQEEEGNL 199
           +R + H E    A E+F C+ E  GNL
Sbjct: 119 DRPAPHDEACERAYESFRCYYEHYGNL 145


>AF393485-1|AAL60410.1|  289|Anopheles gambiae odorant binding
           protein 1 protein.
          Length = 289

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 119 ERGSSH*EITGYAKEAFFCHQEEEGNL 199
           +R + H E    A E+F C+ E  GNL
Sbjct: 135 DRPAPHDEACERAYESFRCYYEHYGNL 161


>AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase
           subunit 2 protein.
          Length = 686

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 7/19 (36%), Positives = 12/19 (63%)
 Frame = +2

Query: 323 IRIRGINQVSPKSVKFCNC 379
           + +  IN+ S +  +FCNC
Sbjct: 564 VALSNINEPSTEQFRFCNC 582


>DQ518577-1|ABF66619.1|  318|Anopheles gambiae putative secreted
           carbonic anhydrase protein.
          Length = 318

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 10/20 (50%), Positives = 12/20 (60%)
 Frame = -3

Query: 526 LANPRLILTHGHSLSWGIPK 467
           L  P  I  +GHS+S  IPK
Sbjct: 84  LPGPMTIHNNGHSVSLSIPK 103


>AY146755-1|AAO12070.1|  320|Anopheles gambiae odorant-binding
           protein AgamOBP32 protein.
          Length = 320

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +2

Query: 128 SSH*EITGYAKEAFFCHQEEEGNL 199
           S H ++   A E+F C+ E+ GN+
Sbjct: 122 SPHVDVCERAYESFRCYYEQYGNI 145


>AY146754-1|AAO12069.1|  334|Anopheles gambiae odorant-binding
           protein AgamOBP33 protein.
          Length = 334

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 9/24 (37%), Positives = 15/24 (62%)
 Frame = +2

Query: 128 SSH*EITGYAKEAFFCHQEEEGNL 199
           S H ++   A E+F C+ E+ GN+
Sbjct: 122 SPHVDVCERAYESFRCYYEQYGNI 145


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 643,728
Number of Sequences: 2352
Number of extensions: 13161
Number of successful extensions: 65
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 65
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 65
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 66904800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -