SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol ...    25   2.3  
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript...    25   2.3  
AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase ...    25   3.0  
AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona...    23   6.9  
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    23   9.1  

>AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol
           kinase protein.
          Length = 555

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 24/92 (26%), Positives = 37/92 (40%)
 Frame = +2

Query: 404 DSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFMVRGACAPSSSKWSKQIHHHFASWLLIP 583
           + + G   +  +VY  P F   Y P  R D    RG     +S  +K   HHF    L  
Sbjct: 345 EEIAGSVSSTGDVYFVPAFTGLYAPYWRKD---ARGIFCGLTSFTTK---HHFVRAALEA 398

Query: 584 *YTVTVNRLNVRKKRKH*MLSAMMTSAVVANN 679
               T + +   KK     L+ + T  ++A+N
Sbjct: 399 VCFQTRDIIEAMKKDCGINLNKLHTDGIMASN 430


>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1099

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 9/29 (31%), Positives = 17/29 (58%)
 Frame = +1

Query: 76  IYRPRSSVARTDPTVSLSKKQSAMTTQSW 162
           +Y+  S+V RTD   ++ K++   T + W
Sbjct: 849 VYQRLSAVNRTDTRANIRKQERQATIEQW 877


>AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase
           protein.
          Length = 849

 Score = 24.6 bits (51), Expect = 3.0
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = -2

Query: 416 PQLNHQLAVCGLVFHISLKDTERWIPHQKDAHEGCFSQHGSS 291
           P L    ++  L+ H  L+     IP+  D H+G  S H SS
Sbjct: 673 PSLKEDNSLLSLIGHFFLQTP---IPNNGDVHQGGDSNHTSS 711


>AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate
           anion exchanger protein.
          Length = 1102

 Score = 23.4 bits (48), Expect = 6.9
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = -2

Query: 362 KDTERWIPHQKDAHEG 315
           K+T RW+  ++D  EG
Sbjct: 124 KETARWVKFEEDVEEG 139


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
            transcriptase protein.
          Length = 1049

 Score = 23.0 bits (47), Expect = 9.1
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 64   KALMIYRPRSSVARTDPTVSLS 129
            + L + +PRSS  R+DP   +S
Sbjct: 998  ETLRLAQPRSSAGRSDPMFRMS 1019


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 732,899
Number of Sequences: 2352
Number of extensions: 14928
Number of successful extensions: 18
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 69831885
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -