SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30114.Seq
         (672 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF236124-1|AAF68382.1|  107|Anopheles gambiae thioredoxin 1 prot...    36   9e-04
Z22930-3|CAA80515.1|  275|Anopheles gambiae trypsin protein.           25   1.6  
AJ237664-1|CAB40379.2|   81|Anopheles gambiae putative infection...    25   2.2  
U51225-1|AAA96405.1|  692|Anopheles gambiae hexamerin protein.         24   3.8  
AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein...    24   3.8  
AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein...    24   3.8  
AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein...    24   3.8  
AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein...    24   3.8  
AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein...    24   3.8  
AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein...    24   3.8  
AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein...    24   3.8  
AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein...    24   3.8  
AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein...    24   3.8  
AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein...    24   3.8  
AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein...    24   3.8  
AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein...    24   3.8  
AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein...    24   3.8  
AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein...    24   3.8  
AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein...    24   3.8  
AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein...    24   3.8  
AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein...    24   3.8  
AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein...    24   3.8  
AF020872-1|AAC31875.1|  692|Anopheles gambiae hexamerin A protein.     24   3.8  
AF020871-1|AAC31874.1|  692|Anopheles gambiae hexamerin A protein.     24   3.8  
AF020870-1|AAC31873.1|  692|Anopheles gambiae hexamerin A protein.     24   3.8  
Z81292-1|CAB03593.1|  209|Anopheles gambiae GSTD1-6 protein prot...    23   6.6  
AY280612-1|AAQ21365.1|  309|Anopheles gambiae carbonic anhydrase...    23   6.6  
AF071160-1|AAC79995.1|  209|Anopheles gambiae glutathione S-tran...    23   6.6  
AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR prot...    23   8.8  

>AF236124-1|AAF68382.1|  107|Anopheles gambiae thioredoxin 1
           protein.
          Length = 107

 Score = 36.3 bits (80), Expect = 9e-04
 Identities = 12/32 (37%), Positives = 22/32 (68%)
 Frame = +2

Query: 146 EYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 241
           + ++V+F+A WCG CK +AP+  +   K A++
Sbjct: 21  QLVVVDFFATWCGPCKVIAPKLEEFQNKYADK 52



 Score = 28.3 bits (60), Expect = 0.23
 Identities = 11/50 (22%), Positives = 25/50 (50%)
 Frame = +1

Query: 256 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 405
           + KVD  + ++LA  Y +   PT  F +    +    G  A+ + +++++
Sbjct: 55  VVKVDVDECEELAAQYNIASMPTFLFIKRKEVVGQFSGANAEKLENFIQQ 104


>Z22930-3|CAA80515.1|  275|Anopheles gambiae trypsin protein.
          Length = 275

 Score = 25.4 bits (53), Expect = 1.6
 Identities = 16/53 (30%), Positives = 24/53 (45%)
 Frame = -3

Query: 643 LRSS*KAQHLHLQPPTP*ITFSSLTIANTWSSTT*AVERKVLALASSGPKRNQ 485
           L  S K Q + L      +    +TI + W ST  A+E   +  A++ P  NQ
Sbjct: 144 LTFSNKVQPITLPEQDEAVEDGIMTIVSGWGSTKSAIESNAILRAANVPTVNQ 196


>AJ237664-1|CAB40379.2|   81|Anopheles gambiae putative infection
           responsive shortpeptide protein.
          Length = 81

 Score = 25.0 bits (52), Expect = 2.2
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEY 211
           +V  YAP C  CKS+   Y
Sbjct: 21  MVFAYAPTCARCKSIGARY 39


>U51225-1|AAA96405.1|  692|Anopheles gambiae hexamerin protein.
          Length = 692

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 501 VRKETKYNNSIGIDKFFSLFSRGDLNSRG 415
           V  ETKYN+   + +FF  +  G    +G
Sbjct: 66  VSDETKYNDFAQVAEFFDYYKTGAFLEKG 94


>AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 80  IIMFYADWCFACMKAANSFKK 100


>AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 80  IIMFYADWCFACMKAANSFKK 100


>AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 82  IIMFYADWCFACMKAANSFKK 102


>AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 82  IIMFYADWCFACMKAANSFKK 102


>AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 85  IIMFYADWCFACMKAANSFKK 105


>AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 85  IIMFYADWCFACMKAANSFKK 105


>AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 95  IIMFYADWCFACMKAANSFKK 115


>AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 97  IIMFYADWCFACMKAANSFKK 117


>AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 97  IIMFYADWCFACMKAANSFKK 117


>AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 79  IIMFYADWCFACMKAANSFKK 99


>AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 79  IIMFYADWCFACMKAANSFKK 99


>AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 155 LVEFYAPWCGHCKSLAPEYAK 217
           ++ FYA WC  C   A  + K
Sbjct: 94  IIMFYADWCFACMKAANSFKK 114


>AF020872-1|AAC31875.1|  692|Anopheles gambiae hexamerin A protein.
          Length = 692

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 501 VRKETKYNNSIGIDKFFSLFSRGDLNSRG 415
           V  ETKYN+   + +FF  +  G    +G
Sbjct: 66  VSDETKYNDFAQVAEFFDYYKTGAFLEKG 94


>AF020871-1|AAC31874.1|  692|Anopheles gambiae hexamerin A protein.
          Length = 692

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 501 VRKETKYNNSIGIDKFFSLFSRGDLNSRG 415
           V  ETKYN+   + +FF  +  G    +G
Sbjct: 66  VSDETKYNDFAQVAEFFDYYKTGAFLEKG 94


>AF020870-1|AAC31873.1|  692|Anopheles gambiae hexamerin A protein.
          Length = 692

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = -1

Query: 501 VRKETKYNNSIGIDKFFSLFSRGDLNSRG 415
           V  ETKYN+   + +FF  +  G    +G
Sbjct: 66  VSDETKYNDFAQVAEFFDYYKTGAFLEKG 94


>Z81292-1|CAB03593.1|  209|Anopheles gambiae GSTD1-6 protein
           protein.
          Length = 209

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 5/62 (8%)
 Frame = +2

Query: 44  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEF-----YAPWCGHCKSLAPE 208
           A+  L   L  +     N L ++  +    I T E    +F      A W   CK+ AP 
Sbjct: 133 AVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPG 192

Query: 209 YA 214
           YA
Sbjct: 193 YA 194


>AY280612-1|AAQ21365.1|  309|Anopheles gambiae carbonic anhydrase
           protein.
          Length = 309

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 189 QWPHHGA*NSTKMYSVVVITVSKLALLKTSTFS 91
           +W  HG   +TKM S VV   + + L+ TS  S
Sbjct: 275 EWDQHGNNFATKMTSNVVFLGAIVLLVITSRLS 307


>AF071160-1|AAC79995.1|  209|Anopheles gambiae glutathione
           S-transferase protein.
          Length = 209

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 17/62 (27%), Positives = 24/62 (38%), Gaps = 5/62 (8%)
 Frame = +2

Query: 44  AIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEF-----YAPWCGHCKSLAPE 208
           A+  L   L  +     N L ++  +    I T E    +F      A W   CK+ AP 
Sbjct: 133 AVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPG 192

Query: 209 YA 214
           YA
Sbjct: 193 YA 194


>AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR
           protein.
          Length = 502

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 8/33 (24%), Positives = 15/33 (45%)
 Frame = -3

Query: 265 LSLVDRRFFFSQLCCCLGVFRCQRFAVAAPWSI 167
           L+LVD + +  ++CC    F        + W +
Sbjct: 178 LNLVDLKIYIQEICCRFFTFSSSLCCFLSVWFV 210


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 631,642
Number of Sequences: 2352
Number of extensions: 12696
Number of successful extensions: 85
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 84
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 85
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 67322955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -