SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30112.Seq
         (446 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF588632-1|ABQ96822.1|  176|Anopheles gambiae transposase protein.     27   0.40 
AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s...    23   3.7  
CR954257-8|CAJ14159.1|  562|Anopheles gambiae putative esterase ...    23   6.5  

>EF588632-1|ABQ96822.1|  176|Anopheles gambiae transposase protein.
          Length = 176

 Score = 26.6 bits (56), Expect = 0.40
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
 Frame = +3

Query: 213 GIECCYGVSVXETRVGSTAENVSRKATAVN--L*YMKKLQTVPK 338
           G +C YG+ V +   G+T+ N+ R    V+  + Y+K+ Q +P+
Sbjct: 21  GAKCLYGLKVFKYNKGTTS-NLKRHLNLVHKTVPYLKQKQPIPQ 63


>AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl
           symporter protein.
          Length = 1127

 Score = 23.4 bits (48), Expect = 3.7
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
 Frame = -1

Query: 377 ITVYCYTKIQQSFLRDSLKLLHISKI--DCSSLSRNILRRASDSGL 246
           I+ Y  T +      D L    +S +   C SLSRN+ + +S S L
Sbjct: 836 ISEYPRTLVANDSTNDLLSHNKVSSLHGSCDSLSRNVSQASSTSDL 881


>CR954257-8|CAJ14159.1|  562|Anopheles gambiae putative esterase
           protein.
          Length = 562

 Score = 22.6 bits (46), Expect = 6.5
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = -3

Query: 144 YTNHLPCGTDPLVQWNLFH 88
           Y    P G D +V+W  FH
Sbjct: 386 YWQDRPLGNDIMVEWLTFH 404


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 417,388
Number of Sequences: 2352
Number of extensions: 9051
Number of successful extensions: 11
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 37843779
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -