SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette...    27   0.46 
U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette...    27   0.46 
U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette...    27   0.46 
AF387862-1|AAL56547.1|  476|Anopheles gambiae gag polyprotein pr...    27   0.60 
AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenin...    25   1.8  
AY579078-1|AAT81602.1|  425|Anopheles gambiae neuropeptide F rec...    25   2.4  
AJ515150-1|CAD56157.2|  737|Anopheles gambiae acetylcholinestera...    24   3.2  
AJ515149-1|CAD56156.1|  737|Anopheles gambiae acetylcholinestera...    24   3.2  
AJ488492-1|CAD32684.2|  623|Anopheles gambiae acetylcholinestera...    24   3.2  
AF080566-1|AAC31946.1|  308|Anopheles gambiae abdominal-A homeot...    24   3.2  
DQ013245-1|AAY34441.1|  487|Anopheles gambiae adrenodoxin reduct...    23   7.4  
AF269155-1|AAF91400.1|   59|Anopheles gambiae transcription fact...    23   7.4  

>U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 27.1 bits (57), Expect = 0.46
 Identities = 9/21 (42%), Positives = 17/21 (80%)
 Frame = +3

Query: 198 VDDIGDVTVTNEGATILKMWK 260
           +DD  + T+TN+ AT++++WK
Sbjct: 34  MDDALNTTLTNDKATLIQVWK 54


>U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 27.1 bits (57), Expect = 0.46
 Identities = 9/21 (42%), Positives = 17/21 (80%)
 Frame = +3

Query: 198 VDDIGDVTVTNEGATILKMWK 260
           +DD  + T+TN+ AT++++WK
Sbjct: 34  MDDALNTTLTNDKATLIQVWK 54


>U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 673

 Score = 27.1 bits (57), Expect = 0.46
 Identities = 9/21 (42%), Positives = 17/21 (80%)
 Frame = +3

Query: 198 VDDIGDVTVTNEGATILKMWK 260
           +DD  + T+TN+ AT++++WK
Sbjct: 12  MDDALNTTLTNDKATLIQVWK 32


>AF387862-1|AAL56547.1|  476|Anopheles gambiae gag polyprotein
           protein.
          Length = 476

 Score = 26.6 bits (56), Expect = 0.60
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +1

Query: 487 TWQAVSDHTAKTTMSSKL 540
           TW A+  H  KTTMS+K+
Sbjct: 80  TWDALQKHHQKTTMSTKV 97


>AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenine
           transaminase protein.
          Length = 396

 Score = 25.0 bits (52), Expect = 1.8
 Identities = 9/32 (28%), Positives = 16/32 (50%)
 Frame = +2

Query: 206 YWGCYSH*RRCHNIKNVEVEHPAAKVLVELAQ 301
           YWGCY   +R H+     +     + L ++A+
Sbjct: 246 YWGCYDEPKRYHHTVASNLIFALREALAQIAE 277


>AY579078-1|AAT81602.1|  425|Anopheles gambiae neuropeptide F
           receptor protein.
          Length = 425

 Score = 24.6 bits (51), Expect = 2.4
 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 4/39 (10%)
 Frame = -1

Query: 224 DCNIPNIVNQHLIQT--NWP--KGALYYVCYSRCCHYIL 120
           D N+P++  +++     +WP   G +YY  ++ C  Y+L
Sbjct: 186 DVNLPSLGIEYVSYCIEDWPIAYGRVYYSAFTLCVQYVL 224


>AJ515150-1|CAD56157.2|  737|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 737

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +2

Query: 74  FVCSRDKILRRPSENTKCNGSSGYSKHSKELPWASWSG 187
           F C+ ++  +R +E         Y+  SK  PW  W+G
Sbjct: 560 FTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTG 597


>AJ515149-1|CAD56156.1|  737|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 737

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +2

Query: 74  FVCSRDKILRRPSENTKCNGSSGYSKHSKELPWASWSG 187
           F C+ ++  +R +E         Y+  SK  PW  W+G
Sbjct: 560 FTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTG 597


>AJ488492-1|CAD32684.2|  623|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 623

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +2

Query: 74  FVCSRDKILRRPSENTKCNGSSGYSKHSKELPWASWSG 187
           F C+ ++  +R +E         Y+  SK  PW  W+G
Sbjct: 446 FTCNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTG 483


>AF080566-1|AAC31946.1|  308|Anopheles gambiae abdominal-A homeotic
           protein protein.
          Length = 308

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 11/40 (27%), Positives = 18/40 (45%)
 Frame = -1

Query: 125 ILCSHWVSAGSCPCYRQRCSYSRHFLLYF*HKIHFKIAVT 6
           ++C  +     CP  R R +Y+R   L    + HF   +T
Sbjct: 125 VVCGDFAGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLT 164


>DQ013245-1|AAY34441.1|  487|Anopheles gambiae adrenodoxin reductase
           protein.
          Length = 487

 Score = 23.0 bits (47), Expect = 7.4
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = -3

Query: 510 VIRDGLPSDSTVTVRLS*MYLTASLQARRYPEIMLVG 400
           ++R  LP+ S V V    ++  AS  A   P I +VG
Sbjct: 1   MLRKVLPTSSAVKVARKCVFRNASTAAPIRPRICIVG 37


>AF269155-1|AAF91400.1|   59|Anopheles gambiae transcription
          factor Deformed protein.
          Length = 59

 Score = 23.0 bits (47), Expect = 7.4
 Identities = 9/25 (36%), Positives = 15/25 (60%)
 Frame = -1

Query: 80 RQRCSYSRHFLLYF*HKIHFKIAVT 6
          RQR +Y+RH +L    + H+   +T
Sbjct: 3  RQRTAYTRHQILELEKEFHYNXYLT 27


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 605,390
Number of Sequences: 2352
Number of extensions: 11175
Number of successful extensions: 26
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57188952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -