SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30109.Seq
         (654 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    28   0.22 
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    28   0.22 
EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    25   2.8  
CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ...    23   8.4  
AY176050-1|AAO19581.1|  522|Anopheles gambiae cytochrome P450 CY...    23   8.4  

>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
            protease protein.
          Length = 1322

 Score = 28.3 bits (60), Expect = 0.22
 Identities = 8/22 (36%), Positives = 15/22 (68%)
 Frame = +1

Query: 217  GRHCGFGKRRGTAMRVCHRRNY 282
            G+HCG+  + G  ++V H R++
Sbjct: 1287 GKHCGYANKPGVYLKVAHYRDW 1308


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
            protein.
          Length = 1322

 Score = 28.3 bits (60), Expect = 0.22
 Identities = 8/22 (36%), Positives = 15/22 (68%)
 Frame = +1

Query: 217  GRHCGFGKRRGTAMRVCHRRNY 282
            G+HCG+  + G  ++V H R++
Sbjct: 1287 GKHCGYANKPGVYLKVAHYRDW 1308


>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
            channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 11/38 (28%), Positives = 21/38 (55%)
 Frame = +1

Query: 49   CGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKP 162
            CG K++ +DP    E+        +R+M K+ ++ K+P
Sbjct: 1179 CGSKQLDIDP---QEVVGGAGACGVRRMAKEKMLRKRP 1213


>CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein
           protein.
          Length = 1087

 Score = 23.0 bits (47), Expect = 8.4
 Identities = 7/20 (35%), Positives = 12/20 (60%)
 Frame = +2

Query: 176 PAPVSAKTQRHVERVVTVAL 235
           P P+  KT  H+E++  + L
Sbjct: 59  PNPLEQKTNAHIEKIFLITL 78


>AY176050-1|AAO19581.1|  522|Anopheles gambiae cytochrome P450
           CYP12F2 protein.
          Length = 522

 Score = 23.0 bits (47), Expect = 8.4
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +1

Query: 100 NTNSRQNIRKMIKDGLVIKKPVAVHSRARVR 192
           N ++   +R  IK+GL + +PVA + RA  R
Sbjct: 370 NMHNLPYLRACIKEGLRMYQPVAGNMRAAGR 400


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 649,070
Number of Sequences: 2352
Number of extensions: 12954
Number of successful extensions: 31
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64814025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -