SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc...    24   3.2  
AJ439060-18|CAD27769.1|  257|Anopheles gambiae hypothetical prot...    24   4.2  
AF364132-1|AAL35508.1|  397|Anopheles gambiae putative odorant r...    23   5.6  
AY745213-1|AAU93480.1|  171|Anopheles gambiae cytochrome P450 pr...    23   7.4  
AF080566-1|AAC31946.1|  308|Anopheles gambiae abdominal-A homeot...    23   7.4  
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    23   9.8  

>EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium
           channel alpha2-delta subunit 1 protein.
          Length = 1256

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = -1

Query: 246 KLMSRYNQCNQVQQCRNPTILCIQGIS 166
           +L+ +YNQ +Q  QC    +L   G S
Sbjct: 360 ELLRKYNQSSQGSQCNQAIMLITDGPS 386


>AJ439060-18|CAD27769.1|  257|Anopheles gambiae hypothetical protein
           protein.
          Length = 257

 Score = 23.8 bits (49), Expect = 4.2
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = -2

Query: 365 LHIATCFWQKKKQFYNGMELTAKITTPSILHTN 267
           L +   F Q+ KQF N     AK  +P   H+N
Sbjct: 144 LRLKHTFAQEAKQFCNAEIRAAKADSPENCHSN 176


>AF364132-1|AAL35508.1|  397|Anopheles gambiae putative odorant
           receptor Or4 protein.
          Length = 397

 Score = 23.4 bits (48), Expect = 5.6
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +1

Query: 352 VAICNYVCN*VVFLSIDNIGKHS*LHITQTIK 447
           V +C YVCN  V     +IG H  L+   TI+
Sbjct: 197 VVMCGYVCNLKVMTICCSIG-HCTLYTRMTIE 227


>AY745213-1|AAU93480.1|  171|Anopheles gambiae cytochrome P450
           protein.
          Length = 171

 Score = 23.0 bits (47), Expect = 7.4
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = -3

Query: 88  RQLEYNKRLPSTSTE*CPIRSKLGHK 11
           +Q+EY +R+   S   CP+ +  G K
Sbjct: 99  KQMEYLERVIKESQRLCPVAAVYGRK 124


>AF080566-1|AAC31946.1|  308|Anopheles gambiae abdominal-A homeotic
           protein protein.
          Length = 308

 Score = 23.0 bits (47), Expect = 7.4
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = -2

Query: 563 LWQYAGKNWMRKVEDRALCG 504
           L ++A  +WM    DR +CG
Sbjct: 109 LQKFASTDWMSNPFDRVVCG 128


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 22.6 bits (46), Expect = 9.8
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +3

Query: 195 DCGIVVLDYTGCIWTSILAENR 260
           +C I VL Y   +W  IL E +
Sbjct: 817 NCAISVLRYGAPVWAHILKEKQ 838


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 645,117
Number of Sequences: 2352
Number of extensions: 13788
Number of successful extensions: 20
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 56768445
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -