SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30107.Seq
         (684 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta...    26   0.96 
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          23   9.0  
CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.          23   9.0  
AF457546-1|AAL68776.1|  182|Anopheles gambiae 30 kDa protein pro...    23   9.0  

>AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing
            phosphoprotein protein.
          Length = 1200

 Score = 26.2 bits (55), Expect = 0.96
 Identities = 21/61 (34%), Positives = 29/61 (47%)
 Frame = +2

Query: 125  RCGSSEQIRSFLGR*DRSS*CVKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRK 304
            R GS  + RS  G   R+      +RAG G++    RSR R +S+     AKG    +R 
Sbjct: 1070 RSGSGSRSRSRSGSGSRAG-----SRAGSGSRS---RSRSRSRSRSRSGSAKGSRSRSRS 1121

Query: 305  G 307
            G
Sbjct: 1122 G 1122



 Score = 23.4 bits (48), Expect = 6.8
 Identities = 14/50 (28%), Positives = 23/50 (46%)
 Frame = +2

Query: 197  ARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTSK 346
            +R+G G  +   RSR R QS    K   G    +R G + ++  +   S+
Sbjct: 1119 SRSGSGGSRSRSRSRSRSQSAGSRK--SGSRSRSRSGSQASRGSRRSRSR 1166


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 13/52 (25%), Positives = 22/52 (42%)
 Frame = +2

Query: 188 VKSARAGEGAQKEDQRSRKREQSKPEPKPAKGVTVPTRKGIKETQNVKSXTS 343
           +K + + +  Q+ED RSR    +  +  PA           KE + +   TS
Sbjct: 679 IKRSHSAQLPQREDARSRTPLTAVSDYSPATAAAAAAAAAAKERELLMYETS 730


>CR954256-3|CAJ14144.1|  659|Anopheles gambiae cyclin protein.
          Length = 659

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +2

Query: 203 AGEGAQKEDQRSRKREQSKPEPKPAKGV-TVPTRKG 307
           A E  +K+ Q  RK+++ +  P PA  V TV    G
Sbjct: 297 AVEALKKKYQEQRKKDRPEAAPAPAPTVITVDRNNG 332


>AF457546-1|AAL68776.1|  182|Anopheles gambiae 30 kDa protein
           protein.
          Length = 182

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +2

Query: 194 SARAGEGAQKEDQRSRKREQSK 259
           SA  GEG +KE  R+  R+  K
Sbjct: 149 SASGGEGGEKESPRNTYRQVHK 170


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 570,321
Number of Sequences: 2352
Number of extensions: 9329
Number of successful extensions: 26
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68995575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -