SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30102.Seq
         (594 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.           26   0.80 
AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.    24   3.2  
AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase...    23   5.6  
DQ370042-1|ABD18603.1|  194|Anopheles gambiae putative TIL domai...    23   7.4  
AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding pr...    23   9.8  
AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding pr...    23   9.8  

>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
          Length = 1664

 Score = 26.2 bits (55), Expect = 0.80
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 353 KLNDDFGTGPDEDLSFPSLFS 415
           +L DDF TGPD + + P++FS
Sbjct: 609 ELRDDFPTGPDPNFN-PNIFS 628


>AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein.
          Length = 1036

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = -3

Query: 466 AMVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKV 365
           A+  +N+L+ +      A+KR + Q L+R C K+
Sbjct: 598 ALRTLNLLNRSTDHALLAQKRQEHQRLVRECDKI 631


>AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase
           subunit 1 protein.
          Length = 688

 Score = 23.4 bits (48), Expect = 5.6
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -2

Query: 224 VPINDIERWTNLLPSRQFGYLVLXTSGGIMXHEEAR 117
           V +ND+ERW + +        VL  SG  +  +E R
Sbjct: 304 VSVNDLERWRDRIHEAIDQGFVLDKSGNRIMLDEQR 339


>DQ370042-1|ABD18603.1|  194|Anopheles gambiae putative TIL domain
           polypeptide protein.
          Length = 194

 Score = 23.0 bits (47), Expect = 7.4
 Identities = 7/28 (25%), Positives = 15/28 (53%)
 Frame = -2

Query: 284 DCCKSHRQTKKCGVISPRFDVPINDIER 201
           D C  + + ++CG   P+    +ND+ +
Sbjct: 33  DLCGPNEEFQECGTACPKTCADLNDLPK 60


>AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding
           protein AgamOBP42 protein.
          Length = 288

 Score = 22.6 bits (46), Expect = 9.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -2

Query: 227 DVPINDIERWTN 192
           D+P +D E+WT+
Sbjct: 165 DIPFSDFEQWTS 176


>AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding
           protein OBPjj83d protein.
          Length = 288

 Score = 22.6 bits (46), Expect = 9.8
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -2

Query: 227 DVPINDIERWTN 192
           D+P +D E+WT+
Sbjct: 165 DIPFSDFEQWTS 176


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 485,468
Number of Sequences: 2352
Number of extensions: 8963
Number of successful extensions: 20
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57188952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -