SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ103706-1|AAZ43087.1|  344|Anopheles gambiae pk-1 receptor prot...    24   5.5  
CR954256-10|CAJ14151.1|  548|Anopheles gambiae putative alkaline...    23   9.7  
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    23   9.7  

>DQ103706-1|AAZ43087.1|  344|Anopheles gambiae pk-1 receptor
           protein.
          Length = 344

 Score = 23.8 bits (49), Expect = 5.5
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +2

Query: 626 LELQPKCLGSRDGQVERKVRPS*RK 700
           L+L+   L  RDG ++R+ +PS R+
Sbjct: 231 LKLRTSTLMQRDGTLQRRTQPSPRQ 255


>CR954256-10|CAJ14151.1|  548|Anopheles gambiae putative alkaline
           phosphatase protein.
          Length = 548

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 17/86 (19%), Positives = 31/86 (36%)
 Frame = +2

Query: 362 LIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRK 541
           L  AA  G+ +A    +      A  A   G+    V   ++ +  P  +         +
Sbjct: 173 LTAAAALGDCQAQNDTSNHVHSIAKWAQDAGLSTGFVTTTEVTNASPAGIYAHTANRNWE 232

Query: 542 YPHTFKKIGYNPAAVAFVPISGWHGD 619
           Y    +K G++PA    +     HG+
Sbjct: 233 YNGAIEKDGFDPAVCQDIASQLIHGE 258


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 16/41 (39%), Positives = 18/41 (43%)
 Frame = -2

Query: 456 TPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVP 334
           T R  AS   S   P   IPA + PVPA      QS   +P
Sbjct: 354 TSRPVASGPTSHYYPS-HIPAGSQPVPAVVNPHQQSRPTIP 393


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 764,474
Number of Sequences: 2352
Number of extensions: 16225
Number of successful extensions: 32
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74428737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -