SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol ...    41   3e-05
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    24   4.6  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    24   4.6  
AY745210-1|AAU93477.1|   86|Anopheles gambiae cytochrome P450 pr...    23   6.1  
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    23   8.0  
DQ314781-1|ABC54566.1|  407|Anopheles gambiae OSKAR protein.           23   8.0  

>AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol
           kinase protein.
          Length = 555

 Score = 41.1 bits (92), Expect = 3e-05
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPS---------PPADTFLPA 357
           +Q+QADL GIPV+R  + E  ALG A+ A +A  V    + +            +TFLP 
Sbjct: 434 MQLQADLSGIPVLRTEVHEPAALGTAMAAAQANGVDLYKLEAEIRGYAGVQSHHETFLPT 493

Query: 356 LTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELL 237
            T             A+ + +GW  +K      + +  LL
Sbjct: 494 TTEEERNARYTKWKMAVQRSLGWAVSKKSEAMTDERYSLL 533



 Score = 32.7 bits (71), Expect = 0.010
 Identities = 21/42 (50%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALEAVC QTR             L +L  DG MA NS+L
Sbjct: 392 VRAALEAVCFQTRDIIEAMKKDCGINLNKLHTDGIMASNSLL 433


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
           phosphatase protein.
          Length = 1977

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +2

Query: 368 MYRPVGWVLSWATHALRDLRQW 433
           +Y P    + W  H +RDLR W
Sbjct: 556 LYMPNRERVLWPAHNVRDLRLW 577


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
           phosphatase protein.
          Length = 1978

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +2

Query: 368 MYRPVGWVLSWATHALRDLRQW 433
           +Y P    + W  H +RDLR W
Sbjct: 556 LYMPNRERVLWPAHNVRDLRLW 577


>AY745210-1|AAU93477.1|   86|Anopheles gambiae cytochrome P450
           protein.
          Length = 86

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 8/19 (42%), Positives = 13/19 (68%)
 Frame = -2

Query: 420 SRNACVAHDNTQPTGRYIP 364
           +R AC++ DN Q   R++P
Sbjct: 17  TRVACLSEDNFQQADRFLP 35


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 1049

 Score = 23.0 bits (47), Expect = 8.0
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -3

Query: 407 VWPTTIPSPPADTFLPAL 354
           V+P+ +P  P D++ PAL
Sbjct: 302 VFPSVVPLVPLDSYHPAL 319


>DQ314781-1|ABC54566.1|  407|Anopheles gambiae OSKAR protein.
          Length = 407

 Score = 23.0 bits (47), Expect = 8.0
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = -2

Query: 615 RPCVTRRAPWRTRWLQTARP*GNSSPTEGWRRTQ 514
           RP   RRAP   R     R  G    + GWR+++
Sbjct: 167 RPYRVRRAPRAERRHPYTRRSGGQQRSAGWRQSR 200


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 670,979
Number of Sequences: 2352
Number of extensions: 15046
Number of successful extensions: 39
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61468785
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -