SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase ...    23   6.3  
X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein...    22   8.3  

>AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase
           protein.
          Length = 808

 Score = 22.6 bits (46), Expect = 6.3
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -1

Query: 293 FDSLKILDPCQGWFVPGLPWLFDTISVSFAVLVMICM 183
           F + + LD C+ +   G     DT+ V F VL +IC+
Sbjct: 610 FKNQEPLDTCKEFMFEGQ----DTLQVIFIVLGLICI 642


>X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein
           Agm2 protein.
          Length = 599

 Score = 22.2 bits (45), Expect = 8.3
 Identities = 6/14 (42%), Positives = 11/14 (78%)
 Frame = -1

Query: 260 GWFVPGLPWLFDTI 219
           G+ +  +PWLF+T+
Sbjct: 215 GFRIDAVPWLFETV 228


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 358,269
Number of Sequences: 2352
Number of extensions: 5699
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 36568146
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -