SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30074.Seq
         (450 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY341209-1|AAR13773.1|  196|Anopheles gambiae SP14D1 protein.          23   3.8  
AY341208-1|AAR13772.1|  196|Anopheles gambiae SP14D1 protein.          23   3.8  
AY341207-1|AAR13771.1|  196|Anopheles gambiae SP14D1 protein.          23   3.8  
AY341206-1|AAR13770.1|  196|Anopheles gambiae SP14D1 protein.          23   3.8  
AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14...    23   3.8  

>AY341209-1|AAR13773.1|  196|Anopheles gambiae SP14D1 protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 296 SLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIW 418
           +L+ F   I  S++  A+CL L+NS   R     + YA+ W
Sbjct: 51  ALIRFNREINYSSTIRAICLPLSNSLRNRKHAGLSSYAAGW 91


>AY341208-1|AAR13772.1|  196|Anopheles gambiae SP14D1 protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 296 SLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIW 418
           +L+ F   I  S++  A+CL L+NS   R     + YA+ W
Sbjct: 51  ALIRFNREINYSSTIRAICLPLSNSLRNRKHAGLSSYAAGW 91


>AY341207-1|AAR13771.1|  196|Anopheles gambiae SP14D1 protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 296 SLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIW 418
           +L+ F   I  S++  A+CL L+NS   R     + YA+ W
Sbjct: 51  ALIRFNREINYSSTIRAICLPLSNSLRNRKHAGLSSYAAGW 91


>AY341206-1|AAR13770.1|  196|Anopheles gambiae SP14D1 protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 296 SLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIW 418
           +L+ F   I  S++  A+CL L+NS   R     + YA+ W
Sbjct: 51  ALIRFNREINYSSTISAICLPLSNSLRNRKHAGLSSYAAGW 91


>AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14D
           protein.
          Length = 360

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 296 SLLHFCYYIFISTSSLAVCLDLNNSHYRRPLFISTYYASIW 418
           +L+ F   I  S++  A+CL L+NS   R     + YA+ W
Sbjct: 215 ALIRFNREINYSSTIRAICLPLSNSLRNRKHAGLSSYAAGW 255


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 414,807
Number of Sequences: 2352
Number of extensions: 7205
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 38268990
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -