SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF281078-2|AAF82132.1|  755|Anopheles gambiae vitellogenin 2 pro...    27   0.57 
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    27   0.57 
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            24   4.0  
AY255857-1|AAP13483.1|  216|Anopheles gambiae glutathione tranfe...    23   7.0  

>AF281078-2|AAF82132.1|  755|Anopheles gambiae vitellogenin 2
           protein.
          Length = 755

 Score = 27.1 bits (57), Expect = 0.57
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = +1

Query: 454 SFRYRYQYRFPNWIPFHHAKSSFGTSA*LCTYLYTL 561
           +++Y Y+Y FP+  PF+     FG       Y+Y +
Sbjct: 16  AYQYSYEYEFPSSRPFNKTGFEFGAWEPNKEYVYNV 51


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1
           protein.
          Length = 2051

 Score = 27.1 bits (57), Expect = 0.57
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = +1

Query: 454 SFRYRYQYRFPNWIPFHHAKSSFGTSA*LCTYLYTL 561
           +++Y Y+Y FP+  PF+     FG       Y+Y +
Sbjct: 16  AYQYSYEYEFPSSRPFNKTGFEFGAWEPNKEYVYNV 51


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +3

Query: 108  AKFLIHRRSPVFLLNRVSITTKKKVHDPSEEELLPIFQY 224
            +KF++ R    FLL   S+ TK++V    +E     + Y
Sbjct: 1187 SKFVVFRPVDSFLLKMTSLFTKQRVRLDQDELRTSSYNY 1225


>AY255857-1|AAP13483.1|  216|Anopheles gambiae glutathione
           tranferase d9 protein.
          Length = 216

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = +3

Query: 60  LFFXCGMLGNLINMYAAKFLIHRRSPV 140
           L F CG L   I +Y +  ++ R +PV
Sbjct: 98  LLFECGTLYKCIFVYYSPVVLERATPV 124


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 726,018
Number of Sequences: 2352
Number of extensions: 15113
Number of successful extensions: 40
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 40
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71504505
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -