SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p...    27   0.53 
AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR prot...    25   3.7  
AY344840-1|AAR05811.1|  221|Anopheles gambiae TEP4 protein.            23   8.6  
AY344839-1|AAR05810.1|  221|Anopheles gambiae TEP4 protein.            23   8.6  

>AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal
           ion/proton exchanger 3 protein.
          Length = 1221

 Score = 27.5 bits (58), Expect = 0.53
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = -1

Query: 279 PNIYYFRLIIEYINSLPFVVPNXMHWDSXSFVLAFELLRFPFKFETD*LTVVHCRQVG 106
           PN ++F ++   I    + +PN M +D+   +L   ++   F   T   ++  C Q G
Sbjct: 303 PNTFFFYMLPPIILDAGYFMPNRMFFDNIGTILLMAVIGTIFNIATIGGSLWACGQTG 360


>AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR
           protein.
          Length = 502

 Score = 24.6 bits (51), Expect = 3.7
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = -2

Query: 314 AVTLALKCLAGTQTFIIFA*LLSILTVYHL*CLI 213
           AVTL+       QTF+ +A +LS++  Y++  L+
Sbjct: 98  AVTLSPAQEFDQQTFVYYAEVLSVINFYYVPALV 131


>AY344840-1|AAR05811.1|  221|Anopheles gambiae TEP4 protein.
          Length = 221

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 10/36 (27%), Positives = 17/36 (47%)
 Frame = +1

Query: 376 WNIEDGSVKQTYNISIENNTKQGSHINAIKIIPHNP 483
           W++   SV   Y + I   T Q + +    I+P+ P
Sbjct: 152 WHLTGFSVDPVYGLGIIKQTLQLTTVQPFYIVPNMP 187


>AY344839-1|AAR05810.1|  221|Anopheles gambiae TEP4 protein.
          Length = 221

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 10/36 (27%), Positives = 17/36 (47%)
 Frame = +1

Query: 376 WNIEDGSVKQTYNISIENNTKQGSHINAIKIIPHNP 483
           W++   SV   Y + I   T Q + +    I+P+ P
Sbjct: 152 WHLTGFSVDPVYGLGIIKQTLQLTTVQPFYIVPNMP 187


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 761,499
Number of Sequences: 2352
Number of extensions: 14220
Number of successful extensions: 91
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 91
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 91
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 87734433
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -