SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ370043-1|ABD18604.1|  161|Anopheles gambiae putative TIL domai...    24   4.9  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    23   6.4  
AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase ...    23   8.5  

>DQ370043-1|ABD18604.1|  161|Anopheles gambiae putative TIL domain
           polypeptide protein.
          Length = 161

 Score = 23.8 bits (49), Expect = 4.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -1

Query: 305 GCPCAVSFRHCY 270
           GC CAV  RH Y
Sbjct: 107 GCNCAVRIRHAY 118


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
            channel alpha subunitprotein.
          Length = 2139

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 9/38 (23%), Positives = 20/38 (52%)
 Frame = -3

Query: 216  YYRAKVYFLMIYHLTFIFILLSQKST*VKIILITEHYY 103
            Y +++ +  ++ +L  IFI +      +KI  +  HY+
Sbjct: 1645 YKQSETFSAVLDYLNMIFICIFSSECLMKIFALRYHYF 1682


>AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase
           protein.
          Length = 808

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +3

Query: 318 NYFTKTPPTNKKLKADATED 377
           NY T T  TNK+L+ + T D
Sbjct: 475 NYNTSTVMTNKELQLNPTTD 494


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 541,915
Number of Sequences: 2352
Number of extensions: 9813
Number of successful extensions: 19
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65232180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -