SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY705404-1|AAU12513.1|  406|Anopheles gambiae nicotinic acetylch...    24   3.5  
AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript...    24   4.6  

>AY705404-1|AAU12513.1|  406|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 9 protein.
          Length = 406

 Score = 24.2 bits (50), Expect = 3.5
 Identities = 9/28 (32%), Positives = 14/28 (50%)
 Frame = -3

Query: 294 GLCTIKWSQPGLC*TPRFRHSVSVIRWD 211
           G     W+ P L   P    +++V+RWD
Sbjct: 87  GWMKFSWNDPKLTWNPASYGNLNVVRWD 114


>AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1248

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +2

Query: 317 RRPRTDIPAPLNGLDTNTSSAVKV*LFLLHRH-IFRCH 427
           RR   +IP  + GL+  +  A++    ++H H ++R H
Sbjct: 713 RRGHPEIPIRVGGLEIRSKQAIRYLGVMIHDHFLWRPH 750


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 610,227
Number of Sequences: 2352
Number of extensions: 11854
Number of successful extensions: 18
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61468785
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -