SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    25   2.8  
AF071161-1|AAC79997.1|  218|Anopheles gambiae glutathione S-tran...    25   2.8  
AF543192-1|AAN40409.1|  636|Anopheles gambiae amino acid transpo...    24   4.9  
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    23   6.4  

>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
           protein.
          Length = 3325

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +3

Query: 231 RAAPYYIRKQEPVDLVERLLEQRALVAEAVRRLKEKKQPCHEIS 362
           R  P  + +     ++ RLL Q   + +A  R   K+ P HEI+
Sbjct: 691 RGPPAEVLRTTCNSILSRLLRQNGKILKANLRAFIKESPMHEIT 734


>AF071161-1|AAC79997.1|  218|Anopheles gambiae glutathione
           S-transferase D7 protein.
          Length = 218

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 428 SDFTTCSTLSQIECFVYKLRIY 363
           +D   C T+SQIE F + L  Y
Sbjct: 157 ADIALCVTVSQIEAFQFDLHPY 178


>AF543192-1|AAN40409.1|  636|Anopheles gambiae amino acid
           transporter Ag_AAT8 protein.
          Length = 636

 Score = 23.8 bits (49), Expect = 4.9
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -1

Query: 137 LCTMAIFTAGFLSQHSGKSLNFKV 66
           L  + I+ A  + +HSGKSLN K+
Sbjct: 585 LLQLPIWAAYAVYKHSGKSLNEKI 608


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1049

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -2

Query: 358  IS*HGCFFSFNLRTASATRARC 293
            +S HGCF S+  R   A+ +RC
Sbjct: 950  LSGHGCFRSYLHRFNRASSSRC 971


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 652,912
Number of Sequences: 2352
Number of extensions: 12530
Number of successful extensions: 16
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65232180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -