SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY263177-1|AAP78792.1|  699|Anopheles gambiae TmcC-like protein ...    28   0.16 
AJ439060-18|CAD27769.1|  257|Anopheles gambiae hypothetical prot...    24   2.6  

>AY263177-1|AAP78792.1|  699|Anopheles gambiae TmcC-like protein
           protein.
          Length = 699

 Score = 28.3 bits (60), Expect = 0.16
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 4/75 (5%)
 Frame = -2

Query: 438 MLIEVICFTISEGECRSITLLW-IRI*KRSQVFEPSPPRSFT---GGDTQDLGWHADWAL 271
           ML+ ++ F I      +I +L+ + + +    F PS P SF+   G  T  + W + W++
Sbjct: 149 MLVNLVVFVILLLAAITIYVLFNVSLAELEPNFTPSHPVSFSEGIGNRTLYMSWPSSWSV 208

Query: 270 YTQLLFLGSID*VST 226
           ++     G+I   ST
Sbjct: 209 FSSASQRGAISFAST 223


>AJ439060-18|CAD27769.1|  257|Anopheles gambiae hypothetical protein
           protein.
          Length = 257

 Score = 24.2 bits (50), Expect = 2.6
 Identities = 9/30 (30%), Positives = 17/30 (56%)
 Frame = -2

Query: 456 TSTPGSMLIEVICFTISEGECRSITLLWIR 367
           +S+P +     +C+ +SE E   I +L+ R
Sbjct: 79  SSSPRTRQFRSVCYYVSESEMEKIEMLFAR 108


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 544,780
Number of Sequences: 2352
Number of extensions: 11708
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 46091631
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -