SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ...    25   1.7  
L11618-1|AAB04104.1|  301|Anopheles gambiae ADP/ATP carrier prot...    25   2.2  
L11617-1|AAB04105.1|  301|Anopheles gambiae ADP/ATP carrier prot...    25   2.2  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    25   2.2  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    24   2.9  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    24   3.9  
AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical prot...    24   3.9  
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    23   5.1  
Z69981-1|CAA93821.1|  327|Anopheles gambiae maltase precursor pr...    23   6.8  

>AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1
           chain protein.
          Length = 1024

 Score = 25.0 bits (52), Expect = 1.7
 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 5/58 (8%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAED----RSAYRRTPAAPGV-APHDKKADVGPGSADLEFKGGYGR 520
           +GP G P AP R   D        +    APGV     +K D+G    D   KG  GR
Sbjct: 166 KGPAGHPGAPGRPGVDGVKGLPGLKGDIGAPGVIGLPGQKGDMGQAGND-GLKGFQGR 222



 Score = 24.2 bits (50), Expect = 2.9
 Identities = 18/47 (38%), Positives = 19/47 (40%)
 Frame = +2

Query: 344 RTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 484
           R E    GPVG P AP R           P APG+ P  K     PG
Sbjct: 62  RGEKGNSGPVGPPGAPGRDG--------MPGAPGL-PGSKGVKGDPG 99


>L11618-1|AAB04104.1|  301|Anopheles gambiae ADP/ATP carrier protein
           protein.
          Length = 301

 Score = 24.6 bits (51), Expect = 2.2
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +2

Query: 467 ADVGPGSADLEFKG 508
           ADVGPG+ + EF G
Sbjct: 145 ADVGPGAGEREFNG 158


>L11617-1|AAB04105.1|  301|Anopheles gambiae ADP/ATP carrier protein
           protein.
          Length = 301

 Score = 24.6 bits (51), Expect = 2.2
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +2

Query: 467 ADVGPGSADLEFKG 508
           ADVGPG+ + EF G
Sbjct: 145 ADVGPGAGEREFNG 158


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 24.6 bits (51), Expect = 2.2
 Identities = 12/33 (36%), Positives = 14/33 (42%)
 Frame = +2

Query: 458 DKKADVGPGSADLEFKGGYGRGRPAS*FKQXKN 556
           DK  +  P S     K GYG G P +     KN
Sbjct: 678 DKLLNTMPASPASSIKSGYGEGAPLAIVAPEKN 710


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
            channel alpha1 subunit protein.
          Length = 1893

 Score = 24.2 bits (50), Expect = 2.9
 Identities = 13/63 (20%), Positives = 33/63 (52%)
 Frame = +2

Query: 146  KHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPA 325
            K+ +L+K     +  A+++   R Y+ +       +W++T++  EY+ IF+ +    +  
Sbjct: 1134 KNCDLDKNQRNCIEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYM-IFVLIMINTITL 1192

Query: 326  TLK 334
            ++K
Sbjct: 1193 SMK 1195


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 23.8 bits (49), Expect = 3.9
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +2

Query: 299 HLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSA 418
           +LP  I P  L+ +      RR  +G  D P  S+ + SA
Sbjct: 455 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSSGNWSA 494


>AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical protein
           protein.
          Length = 765

 Score = 23.8 bits (49), Expect = 3.9
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +2

Query: 299 HLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSA 418
           +LP  I P  L+ +      RR  +G  D P  S+ + SA
Sbjct: 456 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSSGNWSA 495


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
           topoisomerase protein.
          Length = 1039

 Score = 23.4 bits (48), Expect = 5.1
 Identities = 11/30 (36%), Positives = 14/30 (46%)
 Frame = -2

Query: 515 HSLP*IQDQLSLDQHQPFYHEVQHQGQQEY 426
           H LP  Q Q    +H P    + H  QQ+Y
Sbjct: 604 HYLPLQQQQQQQARHLPQQQAIHHIHQQQY 633


>Z69981-1|CAA93821.1|  327|Anopheles gambiae maltase precursor
           protein.
          Length = 327

 Score = 23.0 bits (47), Expect = 6.8
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +1

Query: 106 RGSHGGQKRLSCTEAY*T 159
           +  HGG+ R+  TEAY T
Sbjct: 9   QAEHGGETRVIMTEAYST 26


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 560,186
Number of Sequences: 2352
Number of extensions: 10622
Number of successful extensions: 29
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 52142868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -