SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L36067-1|AAA29362.1|  229|Anopheles gambiae polyubiquitin protein.    141   2e-35
AF510715-1|AAP47144.1|  470|Anopheles gambiae Rh-like glycoprote...    26   0.90 
AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic acetylch...    25   1.6  
AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic acetylch...    25   1.6  
AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein p...    23   6.4  

>L36067-1|AAA29362.1|  229|Anopheles gambiae polyubiquitin protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-35
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-35
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-35
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>AF510715-1|AAP47144.1|  470|Anopheles gambiae Rh-like glycoprotein
           protein.
          Length = 470

 Score = 26.2 bits (55), Expect = 0.90
 Identities = 12/20 (60%), Positives = 12/20 (60%)
 Frame = -3

Query: 646 SVXESEDANFRKDPHGQDHH 587
           S  ESE  N RK PH QD H
Sbjct: 47  SPAESEGGNLRKYPHFQDIH 66


>AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 25.4 bits (53), Expect = 1.6
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 293 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 321


>AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 25.4 bits (53), Expect = 1.6
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 293 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 321


>AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein
           protein.
          Length = 541

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -3

Query: 463 PXGLQYPEGIHPPPGV 416
           P G+  P G H PPG+
Sbjct: 5   PPGVNRPPGSHRPPGL 20


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 552,813
Number of Sequences: 2352
Number of extensions: 10894
Number of successful extensions: 29
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64814025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -