SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    28   0.22 
Z69977-1|CAA93817.1|  151|Anopheles gambiae ribosomal protein RS...    26   1.2  
L76433-1|AAC27659.1|  392|Anopheles gambiae tryptophan oxygenase...    24   3.6  
L76432-1|AAC27663.1|  392|Anopheles gambiae tryptophan oxygenase...    24   3.6  
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    23   8.4  

>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 28.3 bits (60), Expect = 0.22
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 3/40 (7%)
 Frame = +1

Query: 430 EMCTYLLFRAEVRISC--NNDSG-KCVPPRLLVLLIDSIL 540
           E CT    R    + C   N SG KC   RLL  ++DSIL
Sbjct: 769 EYCTTKALRTAKALGCLMRNHSGPKCAKRRLLASVVDSIL 808


>Z69977-1|CAA93817.1|  151|Anopheles gambiae ribosomal protein RS11
           protein.
          Length = 151

 Score = 25.8 bits (54), Expect = 1.2
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +3

Query: 405 RCIDLLYIRNVYLPIVQSRGTYQ 473
           +CI LLYIR  YL  ++   T++
Sbjct: 74  KCIVLLYIRRDYLQFIRKYDTFE 96


>L76433-1|AAC27659.1|  392|Anopheles gambiae tryptophan oxygenase
           protein.
          Length = 392

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +1

Query: 271 LLVEPFVASEGLAEGGDRCLWYLKAPLRDR 360
           ++V+  + S+ L  GG     YL++ L DR
Sbjct: 315 IMVQRMIGSQQLGTGGSSGYQYLRSTLSDR 344


>L76432-1|AAC27663.1|  392|Anopheles gambiae tryptophan oxygenase
           protein.
          Length = 392

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +1

Query: 271 LLVEPFVASEGLAEGGDRCLWYLKAPLRDR 360
           ++V+  + S+ L  GG     YL++ L DR
Sbjct: 315 IMVQRMIGSQQLGTGGSSGYQYLRSTLSDR 344


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 23.0 bits (47), Expect = 8.4
 Identities = 12/43 (27%), Positives = 21/43 (48%)
 Frame = -3

Query: 383 PKRHYGSSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPT 255
           P R     RS     ++   RSPP+   S +T+ ++   ++PT
Sbjct: 252 PSRRNPRRRSPRSGGRWPSCRSPPARRRSRSTRPTSWPRSRPT 294


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 678,595
Number of Sequences: 2352
Number of extensions: 13767
Number of successful extensions: 17
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64395870
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -