SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           26   0.90 
EF426224-1|ABO26467.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426223-1|ABO26466.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426222-1|ABO26465.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426221-1|ABO26464.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426220-1|ABO26463.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426219-1|ABO26462.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426218-1|ABO26461.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426217-1|ABO26460.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426216-1|ABO26459.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426215-1|ABO26458.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426214-1|ABO26457.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426213-1|ABO26456.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426212-1|ABO26455.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426211-1|ABO26454.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426210-1|ABO26453.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426209-1|ABO26452.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426208-1|ABO26451.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426207-1|ABO26450.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426206-1|ABO26449.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426205-1|ABO26448.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426204-1|ABO26447.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426203-1|ABO26446.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426202-1|ABO26445.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426201-1|ABO26444.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426200-1|ABO26443.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426199-1|ABO26442.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426198-1|ABO26441.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426197-1|ABO26440.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426196-1|ABO26439.1|   94|Anopheles gambiae unknown protein.         25   2.1  
EF426195-1|ABO26438.1|   94|Anopheles gambiae unknown protein.         25   2.1  
CR954257-11|CAJ14162.1|  415|Anopheles gambiae predicted protein...    25   2.8  
AF295693-1|AAL55241.1|  786|Anopheles gambiae polyprotein protein.     24   3.7  
AY176048-1|AAO19579.1|  521|Anopheles gambiae cytochrome P450 CY...    24   4.8  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   6.4  

>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 26.2 bits (55), Expect = 0.90
 Identities = 11/35 (31%), Positives = 13/35 (37%)
 Frame = -2

Query: 640 CNTLCDCFNISECSLTCTCAQKPDCLVDSAQG*NI 536
           C  LC C     C    TC     C  D++   NI
Sbjct: 776 CFALCHCCEFDACDCEMTCPNNCACYHDNSWSTNI 810


>EF426224-1|ABO26467.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426223-1|ABO26466.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426222-1|ABO26465.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426221-1|ABO26464.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426220-1|ABO26463.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426219-1|ABO26462.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426218-1|ABO26461.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426217-1|ABO26460.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426216-1|ABO26459.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426215-1|ABO26458.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426214-1|ABO26457.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426213-1|ABO26456.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426212-1|ABO26455.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426211-1|ABO26454.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426210-1|ABO26453.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426209-1|ABO26452.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426208-1|ABO26451.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426207-1|ABO26450.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426206-1|ABO26449.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426205-1|ABO26448.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426204-1|ABO26447.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426203-1|ABO26446.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426202-1|ABO26445.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHT 89


>EF426201-1|ABO26444.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426200-1|ABO26443.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHT 89


>EF426199-1|ABO26442.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426198-1|ABO26441.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426197-1|ABO26440.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>EF426196-1|ABO26439.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHT 89


>EF426195-1|ABO26438.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = +3

Query: 549 CAESTKQSGFCAQVHVRLHS 608
           CAE  K   FC   HVR H+
Sbjct: 70  CAEGCKAGCFCKADHVRKHA 89


>CR954257-11|CAJ14162.1|  415|Anopheles gambiae predicted protein
           protein.
          Length = 415

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = +1

Query: 379 DGRTYCQTCV*NYSLVNWRKPSASTRDCHYQLW 477
           D   +C+ C+   +L+N   PSA+ ++ H +L+
Sbjct: 10  DCTKFCRFCLSEINLLNVIGPSAAEQESHAELF 42


>AF295693-1|AAL55241.1|  786|Anopheles gambiae polyprotein protein.
          Length = 786

 Score = 24.2 bits (50), Expect = 3.7
 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 4/31 (12%)
 Frame = +2

Query: 89  WNDDVAEAGSVVVETM--SLPQAAD--IPEI 169
           W++D AEAG+ V E +  ++P+A    +PE+
Sbjct: 640 WDNDDAEAGAAVPEAVLDAIPEAMPEAVPEV 670


>AY176048-1|AAO19579.1|  521|Anopheles gambiae cytochrome P450
           CYP12F4 protein.
          Length = 521

 Score = 23.8 bits (49), Expect = 4.8
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +3

Query: 18  VLLTVRGYNFYLVIEKYQSWPRRTGM 95
           +++T    +F  V+     WPRRTGM
Sbjct: 96  LVMTFVPEDFEKVLRSEGPWPRRTGM 121


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -3

Query: 624 IVLIFLNAASRAPVHKSQIAWL 559
           I+L+FLN    A  H  Q  WL
Sbjct: 492 IILVFLNTGVLATEHYRQPPWL 513


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 711,515
Number of Sequences: 2352
Number of extensions: 15094
Number of successful extensions: 58
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 58
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64814025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -