SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           27   0.54 
AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          25   2.2  
AJ130951-1|CAA10260.1|  189|Anopheles gambiae SG3 protein protein.     23   6.6  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   8.8  
AJ302655-1|CAC35520.1|  332|Anopheles gambiae gSG5 protein protein.    23   8.8  

>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 26.6 bits (56), Expect = 0.54
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +2

Query: 341  RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 442
            R++  +R +E  +L  EA  A +  N + QP PP
Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134


>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 24.6 bits (51), Expect = 2.2
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +2

Query: 326 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 469
           KH  C  +     +E +++ KEA    +T+NL +     +A  +  GT
Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGT 370


>AJ130951-1|CAA10260.1|  189|Anopheles gambiae SG3 protein protein.
          Length = 189

 Score = 23.0 bits (47), Expect = 6.6
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -1

Query: 240 VTLYTRPVFPWYTLCGIP 187
           V ++ RP  PW+++ GIP
Sbjct: 73  VGIFGRPGRPWWSVPGIP 90


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 22.6 bits (46), Expect = 8.8
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = -3

Query: 304  DALRYNPSANTLVDNHTESMSSHVVH 227
            DA+R   + + +V NH E  S+  +H
Sbjct: 3072 DAIRIGSNESIVVPNHMERSSASSLH 3097


>AJ302655-1|CAC35520.1|  332|Anopheles gambiae gSG5 protein protein.
          Length = 332

 Score = 22.6 bits (46), Expect = 8.8
 Identities = 12/52 (23%), Positives = 24/52 (46%)
 Frame = +2

Query: 227 VYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERL 382
           ++ +  H  GV+V+ + R          + EH++H   R    K  + NE++
Sbjct: 117 LFQIGQHVRGVLVSIKSRMMAYTNDAVAKFEHLRHRTMRAVKRKMDELNEQI 168


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 571,624
Number of Sequences: 2352
Number of extensions: 11173
Number of successful extensions: 58
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 58
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 50881347
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -