SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-15|CAD27766.1|   56|Anopheles gambiae putative ribosoma...    75   1e-15
U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.          23   4.3  
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.          23   4.3  
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.          23   4.3  
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.           22   7.5  

>AJ439060-15|CAD27766.1|   56|Anopheles gambiae putative ribosomal
           protein protein.
          Length = 56

 Score = 74.5 bits (175), Expect = 1e-15
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 146 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           R+CSN HG+IRKYGLNICRQCFREYA DIGF+KLD
Sbjct: 22  RACSNNHGMIRKYGLNICRQCFREYAKDIGFRKLD 56



 Score = 44.0 bits (99), Expect = 2e-06
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MG AN+WYSHPR+YGQGSR
Sbjct: 1   MGFANLWYSHPRKYGQGSR 19


>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 145 PILLQQAWLNPQVRFEHMQTVL 210
           P+LL +A LNP+   E M  ++
Sbjct: 103 PVLLTEAPLNPKANREKMTQIM 124


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 145 PILLQQAWLNPQVRFEHMQTVL 210
           P+LL +A LNP+   E M  ++
Sbjct: 103 PVLLTEAPLNPKANREKMTQIM 124


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 145 PILLQQAWLNPQVRFEHMQTVL 210
           P+LL +A LNP+   E M  ++
Sbjct: 103 PVLLTEAPLNPKANREKMTQIM 124


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +1

Query: 145 PILLQQAWLNPQVRFEHMQTVL 210
           P+LL +A LNP+   E M  ++
Sbjct: 103 PVLLTEAPLNPKSNREKMTQIM 124


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 277,378
Number of Sequences: 2352
Number of extensions: 6141
Number of successful extensions: 10
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 24935070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -