SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY035716-1|AAK61362.1|  136|Anopheles gambiae histone 3A protein.     109   6e-26
Y09952-1|CAA71083.1|  115|Anopheles gambiae histone H3 protein.       104   2e-24

>AY035716-1|AAK61362.1|  136|Anopheles gambiae histone 3A protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-26
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 4e-22
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-15
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Y09952-1|CAA71083.1|  115|Anopheles gambiae histone H3 protein.
          Length = 115

 Score =  104 bits (250), Expect = 2e-24
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 44  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 102



 Score = 89.8 bits (213), Expect = 6e-20
 Identities = 41/43 (95%), Positives = 42/43 (97%)
 Frame = +3

Query: 129 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           RTKQTARKSTGGKAPRKQLA KAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   RTKQTARKSTGGKAPRKQLARKAARKSAPATGGVKKPHRYRPG 43



 Score = 36.7 bits (81), Expect = 6e-04
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKR 475
           GLFEDTNLCAIHAKR
Sbjct: 101 GLFEDTNLCAIHAKR 115


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 556,455
Number of Sequences: 2352
Number of extensions: 9388
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64814025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -