SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF164152-1|AAD47076.1|  261|Anopheles gambiae ribosomal protein ...   319   4e-89
AY994095-1|AAX86008.1|  144|Anopheles gambiae unknown protein.         27   0.39 
AJ439353-4|CAD27926.1|  338|Anopheles gambiae putative hox prote...    25   2.8  
AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical prote...    25   2.8  
AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical prote...    25   2.8  
DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor...    24   4.9  
AY330177-1|AAQ16283.1|  166|Anopheles gambiae odorant-binding pr...    23   6.4  
CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein ...    23   8.5  
AJ439060-4|CAD27755.1|  151|Anopheles gambiae putative sRNP prot...    23   8.5  

>AF164152-1|AAD47076.1|  261|Anopheles gambiae ribosomal protein L8
           protein.
          Length = 261

 Score =  319 bits (784), Expect = 4e-89
 Identities = 145/185 (78%), Positives = 164/185 (88%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G+  L      YAERHGY+KGVVK II DPGRGAPLAVV+FRDPY+F+  K+LFIA 
Sbjct: 22  KRKGQPKLRHL--DYAERHGYLKGVVKQIIQDPGRGAPLAVVNFRDPYRFRLSKQLFIAA 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG+YTGQFVYCG++A L++GNV+P+G MPEGTIVCNLEEK GDRG+LAR SGN+A+VI H
Sbjct: 80  EGMYTGQFVYCGRRAQLQIGNVIPIGLMPEGTIVCNLEEKTGDRGKLARTSGNYASVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           NPD KRTRVKLPSGAKKVLPS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWP V
Sbjct: 140 NPDTKRTRVKLPSGAKKVLPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 48.0 bits (109), Expect = 3e-07
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +HTKKRKG PKLR L
Sbjct: 7   AQRKGAGSVFRAHTKKRKGQPKLRHL 32


>AY994095-1|AAX86008.1|  144|Anopheles gambiae unknown protein.
          Length = 144

 Score = 27.5 bits (58), Expect = 0.39
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +3

Query: 522 SSNRGMVGIVAGGGRIDKPILKAGRAYHK 608
           S+ +  +G V GG   D  IL  GRAYH+
Sbjct: 81  SAGQVPLGAVVGGHTSDGEILYVGRAYHE 109


>AJ439353-4|CAD27926.1|  338|Anopheles gambiae putative hox protein
           protein.
          Length = 338

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 7/15 (46%), Positives = 13/15 (86%)
 Frame = +2

Query: 524 KQQRHGRYCCWRWTY 568
           +QQ+HG++CC R ++
Sbjct: 280 QQQQHGQHCCCRGSH 294


>AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +3

Query: 153 RHGYIKGVVKDIIHDP 200
           R+  +K ++KDI+HDP
Sbjct: 737 RYTMLKDMIKDIMHDP 752


>AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +3

Query: 153 RHGYIKGVVKDIIHDP 200
           R+  +K ++KDI+HDP
Sbjct: 737 RYTMLKDMIKDIMHDP 752


>DQ989013-1|ABK97614.1|  378|Anopheles gambiae gustatory receptor 24
           protein.
          Length = 378

 Score = 23.8 bits (49), Expect = 4.9
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -1

Query: 425 CQTTSITHFLFKIAHNGTLRHSSNRHHISNFKSCFLSTINKLA 297
           C+T SIT  +        LRH      +S ++S +L  ++KLA
Sbjct: 180 CETLSITAKILAEDFQRALRHVGPAAKVSEYRSLWL-RLSKLA 221


>AY330177-1|AAQ16283.1|  166|Anopheles gambiae odorant-binding
           protein AgamOBP50 protein.
          Length = 166

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 11/44 (25%), Positives = 18/44 (40%)
 Frame = -1

Query: 317 STINKLACVEPFGSNEELLPCLELVWIAEVYNSQRCTSTRVMDY 186
           S + KL C+ PF  + ++  C +L     +     C  T    Y
Sbjct: 8   SVVGKLTCLSPFLQSIKVASCCQLEAFLTLPTYGNCLQTIAEKY 51


>CR954257-4|CAJ14155.1|  196|Anopheles gambiae predicted protein
           protein.
          Length = 196

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 8/23 (34%), Positives = 13/23 (56%)
 Frame = +2

Query: 218 GCCTLPRSIQVQDKEGALHCSRR 286
           GCC LP +   Q K+ + + + R
Sbjct: 16  GCCALPANTNAQTKQDSSNNNNR 38


>AJ439060-4|CAD27755.1|  151|Anopheles gambiae putative sRNP
           protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 574 LSIRPPPATIPTM 536
           + +RPPP  +PTM
Sbjct: 114 MGMRPPPMMVPTM 126


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 747,090
Number of Sequences: 2352
Number of extensions: 16255
Number of successful extensions: 35
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65232180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -