SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ230894-1|ABD94313.1|  315|Anopheles gambiae zinc finger protei...    24   2.2  
DQ230893-1|ABD94311.1|  315|Anopheles gambiae zinc finger protei...    24   2.2  
AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein p...    24   2.9  
AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan transpo...    23   5.1  
AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan transpo...    23   5.1  

>DQ230894-1|ABD94313.1|  315|Anopheles gambiae zinc finger protein
           183 protein.
          Length = 315

 Score = 24.2 bits (50), Expect = 2.2
 Identities = 11/32 (34%), Positives = 14/32 (43%)
 Frame = -2

Query: 414 ICPFLFLSPPSSKCLHLFNATCDLTLQSAHSR 319
           +C   F+ P  +KC H F   C L      SR
Sbjct: 249 VCRESFVDPIVTKCKHYFCERCALAQYKKSSR 280


>DQ230893-1|ABD94311.1|  315|Anopheles gambiae zinc finger protein
           183 protein.
          Length = 315

 Score = 24.2 bits (50), Expect = 2.2
 Identities = 11/32 (34%), Positives = 14/32 (43%)
 Frame = -2

Query: 414 ICPFLFLSPPSSKCLHLFNATCDLTLQSAHSR 319
           +C   F+ P  +KC H F   C L      SR
Sbjct: 249 VCRESFVDPIVTKCKHYFCERCALAQYKKSSR 280


>AB090812-1|BAC57899.1|  541|Anopheles gambiae gag-like protein
           protein.
          Length = 541

 Score = 23.8 bits (49), Expect = 2.9
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = +1

Query: 175 RYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGKNH 300
           R  +T  PR    P+ +++  +KQQ L+   Q   Q +G+ +
Sbjct: 247 RGKATGKPRSQQQPQQQQQPQQKQQQLQRRQQQQQQHQGQRY 288


>AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 23.0 bits (47), Expect = 5.1
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -3

Query: 443 YLLEAFKIGSSVPFSSCHHRAQSACISS 360
           YL+ +F  G  +P+S C+    + CI S
Sbjct: 181 YLIASF--GDPLPWSECNDAWNATCIDS 206


>AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 23.0 bits (47), Expect = 5.1
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -3

Query: 443 YLLEAFKIGSSVPFSSCHHRAQSACISS 360
           YL+ +F  G  +P+S C+    + CI S
Sbjct: 181 YLIASF--GDPLPWSECNDAWNATCIDS 206


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 466,550
Number of Sequences: 2352
Number of extensions: 9361
Number of successful extensions: 49
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 49
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 39119412
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -