SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY334004-1|AAR01129.1|  194|Anopheles gambiae integrin protein.        23   6.4  
AY334003-1|AAR01128.1|  194|Anopheles gambiae integrin protein.        23   6.4  
AY334002-1|AAR01127.1|  194|Anopheles gambiae integrin protein.        23   6.4  
AY334001-1|AAR01126.1|  194|Anopheles gambiae integrin protein.        23   6.4  
AJ304412-1|CAC39105.1|  196|Anopheles gambiae dynamin protein.         23   6.4  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    23   6.4  
AF492464-1|AAM11657.1|  803|Anopheles gambiae beta nu integrin s...    23   6.4  
AF080563-1|AAC31943.1|  310|Anopheles gambiae Ultrabithorax home...    23   6.4  
AF080562-1|AAC31942.1|  327|Anopheles gambiae Ultrabithorax home...    23   6.4  
AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450 pr...    23   8.4  

>AY334004-1|AAR01129.1|  194|Anopheles gambiae integrin protein.
          Length = 194

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +1

Query: 589 FFCIATIILGTYLLL*CYFC 648
           F   A+II+G  L+L CY C
Sbjct: 160 FTIAASIIIGGLLMLFCYRC 179


>AY334003-1|AAR01128.1|  194|Anopheles gambiae integrin protein.
          Length = 194

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +1

Query: 589 FFCIATIILGTYLLL*CYFC 648
           F   A+II+G  L+L CY C
Sbjct: 160 FTIAASIIIGGLLMLFCYRC 179


>AY334002-1|AAR01127.1|  194|Anopheles gambiae integrin protein.
          Length = 194

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +1

Query: 589 FFCIATIILGTYLLL*CYFC 648
           F   A+II+G  L+L CY C
Sbjct: 160 FTIAASIIIGGLLMLFCYRC 179


>AY334001-1|AAR01126.1|  194|Anopheles gambiae integrin protein.
          Length = 194

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +1

Query: 589 FFCIATIILGTYLLL*CYFC 648
           F   A+II+G  L+L CY C
Sbjct: 160 FTIAASIIIGGLLMLFCYRC 179


>AJ304412-1|CAC39105.1|  196|Anopheles gambiae dynamin protein.
          Length = 196

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 11/51 (21%), Positives = 23/51 (45%)
 Frame = +1

Query: 115 TRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 267
           T+ F+   LLA      D     + +  + + RE++ +MY    + + + G
Sbjct: 132 TKDFINGELLAHLYATGDQASMMEESADEAQKREEMLRMYHACKEALRIIG 182


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/31 (32%), Positives = 14/31 (45%)
 Frame = -2

Query: 205 RSC*RLVFLDVKHRKPSACAPTICWS*TCEC 113
           R C RL + ++       C P  C+  T EC
Sbjct: 477 REC-RLGYFNLDAENKFGCTPCFCYGHTLEC 506


>AF492464-1|AAM11657.1|  803|Anopheles gambiae beta nu integrin
           subunit AgBnu protein.
          Length = 803

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +1

Query: 589 FFCIATIILGTYLLL*CYFC 648
           F   A+II+G  L+L CY C
Sbjct: 736 FTIAASIIIGGLLMLFCYRC 755


>AF080563-1|AAC31943.1|  310|Anopheles gambiae Ultrabithorax
           homeotic protein IVa protein.
          Length = 310

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%)
 Frame = +1

Query: 316 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 438
           Y TL+L K+F   H L R       H L   +R  +   + R+ ++KK
Sbjct: 229 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 276


>AF080562-1|AAC31942.1|  327|Anopheles gambiae Ultrabithorax
           homeotic protein IIa protein.
          Length = 327

 Score = 23.4 bits (48), Expect = 6.4
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%)
 Frame = +1

Query: 316 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 438
           Y TL+L K+F   H L R       H L   +R  +   + R+ ++KK
Sbjct: 246 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 293


>AY028784-1|AAK32958.2|  499|Anopheles gambiae cytochrome P450
           protein.
          Length = 499

 Score = 23.0 bits (47), Expect = 8.4
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +1

Query: 184 KPTVSKTEIREKLAKMYKVTPDVVFVFGFK 273
           KPT+    I EKL K  K   D V ++ F+
Sbjct: 49  KPTIHFAYIIEKLYKRLKSKGDYVGIYFFR 78


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 677,185
Number of Sequences: 2352
Number of extensions: 14161
Number of successful extensions: 20
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64814025
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -