SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript...    26   0.85 
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    25   2.6  
EF588664-1|ABQ96850.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588655-1|ABQ96841.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588642-1|ABQ96832.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588641-1|ABQ96831.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588640-1|ABQ96830.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588638-1|ABQ96828.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588633-1|ABQ96823.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588631-1|ABQ96821.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588627-1|ABQ96817.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588620-1|ABQ96810.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588609-1|ABQ96800.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588600-1|ABQ96791.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588599-1|ABQ96790.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588598-1|ABQ96789.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588597-1|ABQ96788.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588596-1|ABQ96787.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588591-1|ABQ96785.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588574-1|ABQ96770.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588569-1|ABQ96767.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588563-1|ABQ96761.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588561-1|ABQ96759.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588560-1|ABQ96758.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588555-1|ABQ96753.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588553-1|ABQ96751.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588527-1|ABQ63483.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588526-1|ABQ63482.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588524-1|ABQ63480.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588523-1|ABQ63479.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588494-1|ABQ96730.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588492-1|ABQ96728.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588457-1|ABQ96693.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588456-1|ABQ96692.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588455-1|ABQ96691.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588436-1|ABQ96672.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588435-1|ABQ96671.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588434-1|ABQ96670.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588433-1|ABQ96669.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588432-1|ABQ96668.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588431-1|ABQ96667.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588430-1|ABQ96666.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588429-1|ABQ96665.1|  177|Anopheles gambiae transposase protein.     23   7.9  
EF588428-1|ABQ96664.1|  177|Anopheles gambiae transposase protein.     23   7.9  
AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR prot...    23   7.9  

>AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1173

 Score = 26.2 bits (55), Expect = 0.85
 Identities = 11/38 (28%), Positives = 23/38 (60%)
 Frame = -2

Query: 539 RYIYNTIIILPSYLRLLQHKHNLLPRKGTKHWSSASHR 426
           R+  ++  +L + ++L +H+H L P++   H  S +HR
Sbjct: 202 RFSVDSSSVLGNGIQLHRHQHQLQPQQRRFHRQSPAHR 239


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQ 100
           F K+ E  ++   LRG+  W+TQ
Sbjct: 396 FQKLREKQQIEEDLRGYLDWITQ 418


>EF588664-1|ABQ96850.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588655-1|ABQ96841.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588642-1|ABQ96832.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588641-1|ABQ96831.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588640-1|ABQ96830.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588638-1|ABQ96828.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588633-1|ABQ96823.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588631-1|ABQ96821.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588627-1|ABQ96817.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588620-1|ABQ96810.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588609-1|ABQ96800.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588600-1|ABQ96791.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588599-1|ABQ96790.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588598-1|ABQ96789.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588597-1|ABQ96788.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588596-1|ABQ96787.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588591-1|ABQ96785.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588574-1|ABQ96770.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588569-1|ABQ96767.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588563-1|ABQ96761.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588561-1|ABQ96759.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588560-1|ABQ96758.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588555-1|ABQ96753.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588553-1|ABQ96751.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588527-1|ABQ63483.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588526-1|ABQ63482.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588524-1|ABQ63480.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588523-1|ABQ63479.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588494-1|ABQ96730.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588492-1|ABQ96728.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588457-1|ABQ96693.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588456-1|ABQ96692.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588455-1|ABQ96691.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588436-1|ABQ96672.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588435-1|ABQ96671.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588434-1|ABQ96670.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588433-1|ABQ96669.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588432-1|ABQ96668.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588431-1|ABQ96667.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588430-1|ABQ96666.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588429-1|ABQ96665.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>EF588428-1|ABQ96664.1|  177|Anopheles gambiae transposase protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -2

Query: 596 KKLINSTTL*IVNRLLYD 543
           KKLINS T  +++R+L D
Sbjct: 97  KKLINSETKKVLDRMLLD 114


>AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR
           protein.
          Length = 502

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = +3

Query: 198 VYLKSVYTVIRTSFLMLCCLVTVITPFPVLGTRLCVCG 311
           +YL++ +T +    +  CC +  +T F +     CV G
Sbjct: 396 IYLETEHTNMNIYLVQNCCQLFFMTNFGINFILYCVSG 433


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 647,941
Number of Sequences: 2352
Number of extensions: 12242
Number of successful extensions: 60
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -